StarFunc result for job id Q13608

User Input

>input (980 residues)
MALAVLRVLEPFPTETPPLAVLLPPGGPWPAAELGLVLALRPAGESPAGPALLVAALEGP
DAGTEEQGPGPPQLLVSRALLRLLALGSGAWVRARAVRRPPALGWALLGTSLGPGLGPRV
GPLLVRRGETLPVPGPRVLETRPALQGLLGPGTRLAVTELRGRARLCPESGDSSRPPPPP
VVSSFAVSGTVRRLQGVLGGTGDSLGVSRSCLRGLGLFQGEWVWVAQARESSNTSQPHLA
RVQVLEPRWDLSDRLGPGSGPLGEPLADGLALVPATLAFNLGCDPLEMGELRIQRYLEGS
IAPEDKGSCSLLPGPPFARELHIEIVSSPHYSTNGNYDGVLYRHFQIPRVVQEGDVLCVP
TIGQVEILEGSPEKLPRWREMFFKVKKTVGEAPDGPASAYLADTTHTSLYMVGSTLSPVP
WLPSEESTLWSSLSPPGLEALVSELCAVLKPRLQPGGALLTGTSSVLLRGPPGCGKTTVV
AAACSHLGLHLLKVPCSSLCAESSGAVETKLQAIFSRARRCRPAVLLLTAVDLLGRDRDG
LGEDARVMAVLRHLLLNEDPLNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQ
RLSILRALTAHLPLGQEVNLAQLARRCAGFVVGDLYALLTHSSRAACTRIKNSGLAGGLT
EEDEGELCAAGFPLLAEDFGQALEQLQTAHSQAVGAPKIPSVSWHDVGGLQEVKKEILET
IQLPLEHPELLSLGLRRSGLLLHGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQ
SEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQ
DVFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKFKLEPSVSLVN
VLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQP
SVSEQELLRYKRIQRKFAAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13608	1.000	1.000	0.000	980	1.000	1.000	Q13608.pdb.gz	PEX6_HUMAN Peroxisomal ATPase PEX6 OS=Homo sapiens OX=9606 GN=PEX6 PE=1 SV=2
2	AFDB:Q99LC9	0.817	0.816	0.000	981	0.873	0.873	Q99LC9.pdb.gz	PEX6_MOUSE Peroxisomal ATPase PEX6 OS=Mus musculus OX=10090 GN=Pex6 PE=1 SV=1
3	AFDB:Q8RY16	0.544	0.563	1.468E-73	941	0.327	0.340	Q8RY16.pdb.gz	PEX6_ARATH Peroxisomal ATPase PEX6 OS=Arabidopsis thaliana OX=3702 GN=PEX6 PE=1 SV=1
4	AFDB:P33760	0.652	0.622	2.315E-66	1030	0.267	0.254	P33760.pdb.gz	PEX6_YEAST Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX6 PE=1 SV=1
5	AFDB:A1Z8D1	0.616	0.666	2.144E-63	899	0.260	0.284	A1Z8D1.pdb.gz	A1Z8D1_DROME Peroxin 6, isoform D OS=Drosophila melanogaster OX=7227 GN=Pex6 PE=4 SV=1
6	AFDB:O13764	0.509	0.525	1.080E-61	948	0.271	0.281	O13764.pdb.gz	PEX6_SCHPO Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pex6 PE=3 SV=1
7	AFDB:P54812	0.563	0.667	1.191E-59	810	0.234	0.283	P54812.pdb.gz	TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.2 PE=1 SV=2
8	AFDB:Q9SCN8	0.515	0.606	4.567E-59	815	0.220	0.265	Q9SCN8.pdb.gz	CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana OX=3702 GN=CDC48D PE=1 SV=1
9	AFDB:P46462	0.523	0.623	2.591E-58	806	0.230	0.279	P46462.pdb.gz	TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus OX=10116 GN=Vcp PE=1 SV=3
10	AFDB:Q9P3A7	0.475	0.551	7.099E-58	815	0.233	0.280	Q9P3A7.pdb.gz	CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc48 PE=1 SV=2
11	PDB:6opcB	0.527	0.673	2.679E-54	741	0.234	0.309	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
12	PDB:7ln6F	0.302	0.391	8.995E-51	714	0.219	0.301	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
13	PDB:7vcsA	0.431	0.517	3.261E-50	766	0.220	0.282	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
14	PDB:5ifwB	0.295	0.388	3.194E-47	702	0.206	0.288	5ifwB.pdb.gz	Quantitative interaction mapping reveals an extended UBX domain in ASPL that disrupts functional p97 hexamers.
15	PDB:6opcF	0.441	0.588	1.799E-45	681	0.231	0.332	6opcF.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
16	PDB:7z11D	0.475	0.616	4.083E-42	734	0.193	0.257	7z11D.pdb.gz	Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.
17	PDB:7mhsE	0.443	0.849	1.022E-36	489	0.174	0.350	7mhsE.pdb.gz	Active conformation of the p97-p47 unfoldase complex.
18	PDB:6oaaE	0.391	0.816	2.984E-29	442	0.172	0.382	6oaaE.pdb.gz	Substrate processing by the Cdc48 ATPase complex is initiated by ubiquitin unfolding.
19	PDB:6mdmD	0.375	0.491	3.070E-25	713	0.135	0.185	6mdmD.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
20	PDB:3j96A	0.381	0.527	4.480E-23	678	0.129	0.186	3j96A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A061IR73	0.0	1612	980	0.887	0.887	PEX6_CRIGR Peroxisomal ATPase PEX6 OS=Cricetulus griseus OX=10029 GN=PEX6 PE=3 SV=1
2	P54777	0.0	1577	978	0.871	0.873	PEX6_RAT Peroxisomal ATPase PEX6 OS=Rattus norvegicus OX=10116 GN=Pex6 PE=1 SV=1
3	Q13608	0.0	1928	980	1.000	1.000	PEX6_HUMAN Peroxisomal ATPase PEX6 OS=Homo sapiens OX=9606 GN=PEX6 PE=1 SV=2
4	Q99LC9	0.0	1611	981	0.881	0.880	PEX6_MOUSE Peroxisomal ATPase PEX6 OS=Mus musculus OX=10090 GN=Pex6 PE=1 SV=1
5	Q8RY16	6.46e-142	449	941	0.310	0.323	PEX6_ARATH Peroxisomal ATPase PEX6 OS=Arabidopsis thaliana OX=3702 GN=PEX6 PE=1 SV=1
6	C8VJ57	8.23e-119	399	1476	0.236	0.157	C8VJ57_EMENI Peroxisomal ATPase PEX6 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02925 PE=4 SV=1
7	O13764	3.88e-118	386	948	0.243	0.251	PEX6_SCHPO Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pex6 PE=3 SV=1
8	P33760	1.08e-115	382	1030	0.230	0.218	PEX6_YEAST Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX6 PE=1 SV=1
9	Q9V5R2	1.53e-115	378	897	0.224	0.245	Q9V5R2_DROME GH14288p1 OS=Drosophila melanogaster OX=7227 GN=Pex6 PE=2 SV=1
10	A1Z8D1	2.01e-115	378	899	0.224	0.245	A1Z8D1_DROME Peroxin 6, isoform D OS=Drosophila melanogaster OX=7227 GN=Pex6 PE=4 SV=1
11	P54812	4.95e-94	318	810	0.189	0.228	TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.2 PE=1 SV=2
12	G5EFR8	2.26e-91	308	720	0.186	0.253	G5EFR8_CAEEL AAA+ ATPase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=prx-6 PE=1 SV=1
13	Q57U74	4.78e-90	311	982	0.172	0.172	Q57U74_TRYB2 Peroxisome assembly protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.930 PE=4 SV=1
14	Q7KN62	6.54e-90	306	801	0.188	0.230	TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster OX=7227 GN=TER94 PE=1 SV=1
15	P25694	9.27e-89	304	835	0.204	0.240	CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC48 PE=1 SV=3
16	O44008	2.07e-88	302	780	0.193	0.242	O44008_9TRYP Valosin-containing protein homolog OS=Trypanosoma brucei OX=5691 GN=VCP PE=4 SV=1
17	P90532	2.14e-88	302	793	0.190	0.235	P90532_DICDI Cell division cycle protein 48 OS=Dictyostelium discoideum OX=44689 GN=cdcD PE=2 SV=2
18	Q9LZF6	2.37e-88	302	810	0.188	0.227	CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana OX=3702 GN=CDC48E PE=2 SV=2
19	Q38B27	3.07e-88	301	780	0.193	0.242	Q38B27_TRYB2 Valosin-containing protein homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1190 PE=4 SV=1
20	Q9SCN8	3.34e-88	302	815	0.179	0.215	CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana OX=3702 GN=CDC48D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	4e-63	223.1	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	0.0007	31.0	AAA domain
3	PF13173 AAA_14	10	17.6	AAA domain
4	PF13191 AAA_16	2.2e-08	46.1	AAA ATPase domain
5	PF13207 AAA_17	0.71	21.7	AAA domain
6	PF13238 AAA_18	0.2	23.6	AAA domain
7	PF13245 AAA_19	0.095	24.4	AAA domain
8	PF07724 AAA_2	50	15.4	AAA domain (Cdc48 subfamily)
9	PF13401 AAA_22	0.002	29.8	AAA domain
10	PF13479 AAA_24	44	15.2	AAA domain
11	PF13481 AAA_25	0.0083	27.2	AAA domain
12	PF13521 AAA_28	3.5	19.3	AAA domain
13	PF13555 AAA_29	1.7e+02	13.3	P-loop containing region of AAA domain
14	PF07726 AAA_3	6.5	18.1	ATPase family associated with various cellular activities (AAA)
15	PF13604 AAA_30	5.6	18.2	AAA domain
16	PF13671 AAA_33	0.00083	31.0	AAA domain
17	PF07728 AAA_5	0.00056	31.4	AAA domain (dynein-related subfamily)
18	PF12775 AAA_7	0.68	21.0	P-loop containing dynein motor region
19	PF17862 AAA_lid_3	0.0035	28.5	AAA+ lid domain
20	PF00005 ABC_tran	2e+02	13.9	ABC transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303511

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331106	0.999	Peroxisome assembly protein 26
2	9606.ENSP00000248633	0.997	Peroxisome biogenesis factor 1
3	9606.ENSP00000391601	0.994	Peroxisomal targeting signal 1 receptor
4	9606.ENSP00000295030	0.989	Peroxisomal membrane protein PEX13
5	9606.ENSP00000482609	0.987	Peroxisome assembly protein 12
6	9606.ENSP00000288774	0.983	Peroxisome biogenesis factor 10
7	9606.ENSP00000349016	0.974	Peroxisomal membrane protein PEX14
8	9606.ENSP00000349543	0.974	Peroxisome biogenesis factor 2
9	9606.ENSP00000315680	0.973	Peroxisomal targeting signal 2 receptor
10	9606.ENSP00000261749	0.929	AN1-type zinc finger protein 6
11	9606.ENSP00000357051	0.926	Peroxisomal biogenesis factor 19
12	9606.ENSP00000356563	0.925	Peroxisomal biogenesis factor 3
13	9606.ENSP00000241041	0.923	Peroxisomal membrane protein PEX16
14	9606.ENSP00000390722	0.912	Peroxisomal membrane protein PMP34
15	9606.ENSP00000419975	0.875	PEX5-related protein
16	9606.ENSP00000300056	0.864	Peroxisomal membrane protein 11A
17	9606.ENSP00000358312	0.796	Peroxisomal membrane protein 11B
18	9606.ENSP00000359233	0.737	ATP-binding cassette sub-family D member 3
19	9606.ENSP00000263038	0.720	Phytanoyl-CoA dioxygenase, peroxisomal
20	9606.ENSP00000466379	0.679	ATPase ASNA1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.993	protein binding
GO:0003824	0.982	catalytic activity
GO:0140657	0.977	ATP-dependent activity
GO:0016787	0.936	hydrolase activity
GO:0016887	0.918	ATP hydrolysis activity
GO:0097159	0.845	organic cyclic compound binding
GO:1901363	0.844	heterocyclic compound binding
GO:0140035	0.831	ubiquitination-like modification-dependent protein binding
GO:0140318	0.828	protein transporter activity
GO:0044877	0.775	protein-containing complex binding
GO:0140036	0.395	ubiquitin-dependent protein binding
GO:0032559	0.315	adenyl ribonucleotide binding
GO:0005524	0.306	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0007031	0.987	peroxisome organization
GO:0015919	0.955	peroxisomal membrane transport
GO:0006625	0.947	protein targeting to peroxisome
GO:0044743	0.940	protein transmembrane import into intracellular organelle
GO:0065002	0.893	intracellular protein transmembrane transport
GO:0016558	0.873	protein import into peroxisome matrix
GO:0008152	0.792	metabolic process
GO:0071704	0.733	organic substance metabolic process
GO:0044237	0.648	cellular metabolic process
GO:0043170	0.608	macromolecule metabolic process
GO:0065007	0.595	biological regulation
GO:0044238	0.373	primary metabolic process
GO:0006807	0.340	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0005829	0.991	cytosol
GO:0031090	0.972	organelle membrane
GO:0005778	0.950	peroxisomal membrane
GO:0031974	0.700	membrane-enclosed lumen
GO:0070013	0.676	intracellular organelle lumen
GO:0005634	0.601	nucleus
GO:0097730	0.537	non-motile cilium
GO:0097731	0.455	9+0 non-motile cilium
GO:0043232	0.442	intracellular non-membrane-bounded organelle
GO:0097733	0.430	photoreceptor cell cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.936	Hydrolases.
RHEA:13065	0.918	ATP + H2O = ADP + H(+) + phosphate

[back to server]