StarFunc result for job id Q13610

User Input

>input (501 residues)
MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEKLQEEGGGSDEEETGSPSE
DGMQSARTQARPREPLEDGDPEDDRTLDDDELAEYDLDKYDEEGDPDAETLGESLLGLTV
YGSNDQDPYVTLKDTEQYEREDFLIKPSDNLIVCGRAEQDQCNLEVHVYNQEEDSFYVHH
DILLSAYPLSVEWLNFDPSPDDSTGNYIAVGNMTPVIEVWDLDIVDSLEPVFTLGSKLSK
KKKKKGKKSSSAEGHTDAVLDLSWNKLIRNVLASASADNTVILWDMSLGKPAASLAVHTD
KVQTLQFHPFEAQTLISGSYDKSVALYDCRSPDESHRMWRFSGQIERVTWNHFSPCHFLA
STDDGFVYNLDARSDKPIFTLNAHNDEISGLDLSSQIKGCLVTASADKYVKIWDILGDRP
SLVHSRDMKMGVLFCSSCCPDLPFIYAFGGQKEGLRVWDISTVSSVNEAFGRRERLVLGS
ARNSSISGPFGSRSSDTPMES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBH5	0.793	0.793	1.327E-94	501	1.000	1.000	A0A024RBH5.pdb.gz
2	AFDB:Q99LL5	0.917	0.917	2.711E-92	501	0.898	0.898	Q99LL5.pdb.gz	PWP1_MOUSE Periodic tryptophan protein 1 homolog OS=Mus musculus OX=10090 GN=Pwp1 PE=1 SV=1
3	AFDB:A1Z8D0	0.755	0.823	1.206E-49	459	0.341	0.373	A1Z8D0.pdb.gz	PWP1_DROME Periodic tryptophan protein 1 homolog OS=Drosophila melanogaster OX=7227 GN=nclb PE=1 SV=1
4	AFDB:Q9P775	0.717	0.697	2.834E-46	516	0.345	0.335	Q9P775.pdb.gz	YBEG_SCHPO Uncharacterized WD repeat-containing protein C17D11.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1711.16 PE=1 SV=1
5	AFDB:P21304	0.675	0.592	1.250E-41	576	0.351	0.306	P21304.pdb.gz	PWP1_YEAST Periodic tryptophan protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PWP1 PE=1 SV=1
6	AFDB:Q57TT6	0.674	0.801	3.521E-34	419	0.240	0.286	Q57TT6.pdb.gz	Q57TT6_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.680 PE=4 SV=1
7	AFDB:O94244	0.527	0.610	1.559E-22	430	0.162	0.188	O94244.pdb.gz	HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis16 PE=1 SV=1
8	AFDB:Q59RH5	0.535	0.694	1.794E-21	382	0.132	0.173	Q59RH5.pdb.gz	HAT2_CANAL Histone acetyltransferase type B subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAT2 PE=3 SV=1
9	AFDB:Q9XF57	0.532	0.827	8.660E-21	317	0.112	0.177	Q9XF57.pdb.gz	PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana OX=3702 GN=PEX7 PE=1 SV=2
10	AFDB:Q9VSN7	0.540	0.787	1.076E-20	339	0.108	0.159	Q9VSN7.pdb.gz	Q9VSN7_DROME Peroxin-7 OS=Drosophila melanogaster OX=7227 GN=Pex7 PE=3 SV=1
11	PDB:6s29C	0.518	0.651	3.492E-20	394	0.146	0.185	6s29C.pdb.gz
12	PDB:3cfvB	0.527	0.664	7.071E-20	393	0.136	0.173	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
13	PDB:2ybaB	0.532	0.690	1.092E-19	382	0.120	0.157	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
14	PDB:6zrdA	0.526	0.635	4.241E-19	411	0.130	0.158	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
15	PDB:3w15A	0.515	0.757	5.874E-19	336	0.106	0.158	3w15A.pdb.gz	Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
16	PDB:4pswB	0.514	0.695	7.299E-19	366	0.118	0.161	4pswB.pdb.gz	Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
17	PDB:3gfcA	0.509	0.740	1.939E-18	339	0.132	0.195	3gfcA.pdb.gz
18	PDB:5c9zB	0.503	0.786	1.526E-17	313	0.096	0.153	5c9zB.pdb.gz	Crystal structure of PRMT5/MEP50 complex with sinefungin and 15866
19	PDB:7mq8LU	0.487	0.545	5.927E-17	445	0.114	0.128	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:4g56D	0.486	0.780	2.066E-16	303	0.116	0.191	4g56D.pdb.gz	Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DJV5	0.0	909	439	0.876	1.000	B4DJV5_HUMAN PWP1 homolog, endonuclein OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1
2	Q13610	0.0	1034	501	1.000	1.000	PWP1_HUMAN Periodic tryptophan protein 1 homolog OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1
3	Q99LL5	0.0	869	501	0.892	0.892	PWP1_MOUSE Periodic tryptophan protein 1 homolog OS=Mus musculus OX=10090 GN=Pwp1 PE=1 SV=1
4	A1Z8D0	7.24e-91	286	459	0.333	0.364	PWP1_DROME Periodic tryptophan protein 1 homolog OS=Drosophila melanogaster OX=7227 GN=nclb PE=1 SV=1
5	Q9P775	1.76e-77	253	516	0.339	0.329	YBEG_SCHPO Uncharacterized WD repeat-containing protein C17D11.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1711.16 PE=1 SV=1
6	P21304	3.12e-68	231	576	0.363	0.316	PWP1_YEAST Periodic tryptophan protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PWP1 PE=1 SV=1
7	Q57TT6	7.84e-45	164	419	0.226	0.270	Q57TT6_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.680 PE=4 SV=1
8	Q8CFJ9	2.66e-14	78.2	790	0.110	0.070	WDR24_MOUSE GATOR2 complex protein WDR24 OS=Mus musculus OX=10090 GN=Wdr24 PE=1 SV=1
9	Q96S15	5.36e-14	77.0	790	0.110	0.070	WDR24_HUMAN GATOR2 complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=2
10	O94244	4.52e-13	73.2	430	0.130	0.151	HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis16 PE=1 SV=1
11	O14021	1.50e-12	71.6	431	0.160	0.186	PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prw1 PE=1 SV=1
12	Q9UTC7	1.61e-12	71.6	462	0.156	0.169	YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.12 PE=4 SV=1
13	A0MNP2	2.34e-12	70.5	357	0.108	0.151	A0MNP2_HUMAN CDW11/WDR57 OS=Homo sapiens OX=9606 GN=WDR57 PE=2 SV=1
14	Q96DI7	2.34e-12	70.5	357	0.108	0.151	SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1
15	O13923	3.14e-12	71.2	601	0.098	0.082	CORO_SCHPO Coronin-like protein crn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crn1 PE=1 SV=1
16	P39984	3.56e-12	70.5	401	0.108	0.135	HAT2_YEAST Histone acetyltransferase type B subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAT2 PE=1 SV=1
17	Q9XZ25	8.59e-12	70.1	776	0.104	0.067	WDR24_DROME GATOR2 complex protein WDR24 OS=Drosophila melanogaster OX=7227 GN=Wdr24 PE=1 SV=1
18	Q86BR7	8.67e-12	70.1	777	0.104	0.067	Q86BR7_DROME GATOR complex protein WDR24 OS=Drosophila melanogaster OX=7227 GN=Wdr24 PE=3 SV=2
19	Q9VSN7	1.22e-11	68.2	339	0.128	0.189	Q9VSN7_DROME Peroxin-7 OS=Drosophila melanogaster OX=7227 GN=Pex7 PE=3 SV=1
20	Q1LV15	1.29e-11	68.6	415	0.138	0.166	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.63	21.7	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16756 PALB2_WD40	1.5e+02	12.7	Partner and localizer of BRCA2 WD40 domain
3	PF00400 WD40	2e-08	45.9	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008213

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003209	0.957	RNA binding motif protein 34
2	61853.ENSNLEP00000016038	0.953	EBNA1 binding protein 2
3	61853.ENSNLEP00000002350	0.943	annotation not available
4	61853.ENSNLEP00000017584	0.938	BRX1, biogenesis of ribosomes, homolog (S. cerevisiae)
5	61853.ENSNLEP00000005134	0.933	pre-rRNA processing protein FTSJ3
6	61853.ENSNLEP00000012425	0.928	Ribosomal L1 domain containing 1
7	61853.ENSNLEP00000015616	0.926	Ribosome production factor 2 homolog (S. cerevisiae)
8	61853.ENSNLEP00000021053	0.925	MYB binding protein (P160) 1a
9	61853.ENSNLEP00000008564	0.917	Ribosome biogenesis protein WDR12
10	61853.ENSNLEP00000015945	0.912	REX4, RNA exonuclease 4 homolog (S. cerevisiae)
11	61853.ENSNLEP00000002040	0.905	RNA helicase
12	61853.ENSNLEP00000016440	0.905	Nucleolar GTP-binding protein 1
13	61853.ENSNLEP00000020935	0.905	DEAD (Asp-Glu-Ala-Asp) box helicase 24
14	61853.ENSNLEP00000000015	0.902	NOC2 like nucleolar associated transcriptional repressor
15	61853.ENSNLEP00000002453	0.902	Notchless homolog 1 (Drosophila)
16	61853.ENSNLEP00000018518	0.902	Uncharacterized protein
17	61853.ENSNLEP00000024355	0.902	Uncharacterized protein
18	61853.ENSNLEP00000006113	0.900	NSA2 ribosome biogenesis homolog (S. cerevisiae)
19	61853.ENSNLEP00000005228	0.888	NOP2 nucleolar protein
20	61853.ENSNLEP00000008834	0.888	RNA helicase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042393	0.991	histone binding
GO:0140597	0.990	protein carrier chaperone
GO:0140034	0.985	methylation-dependent protein binding
GO:0140713	0.857	histone chaperone activity
GO:0035064	0.842	methylated histone binding
GO:0003676	0.582	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0009987	0.987	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0071704	0.975	organic substance metabolic process
GO:0044238	0.973	primary metabolic process
GO:0044237	0.970	cellular metabolic process
GO:0051171	0.969	regulation of nitrogen compound metabolic process
GO:0080090	0.968	regulation of primary metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0048518	0.924	positive regulation of biological process
GO:0048522	0.907	positive regulation of cellular process
GO:0006807	0.906	nitrogen compound metabolic process
GO:0019219	0.889	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.876	regulation of biosynthetic process
GO:0043170	0.855	macromolecule metabolic process
GO:0031326	0.832	regulation of cellular biosynthetic process
GO:0034641	0.829	cellular nitrogen compound metabolic process
GO:0016070	0.819	RNA metabolic process
GO:0006356	0.819	regulation of transcription by RNA polymerase I
GO:0009058	0.811	biosynthetic process
GO:1901576	0.780	organic substance biosynthetic process
GO:0010467	0.777	gene expression
GO:0140747	0.712	regulation of ncRNA transcription
GO:0010557	0.711	positive regulation of macromolecule biosynthetic process
GO:0031328	0.696	positive regulation of cellular biosynthetic process
GO:0045935	0.690	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.633	positive regulation of RNA metabolic process
GO:0044249	0.623	cellular biosynthetic process
GO:1902680	0.552	positive regulation of RNA biosynthetic process
GO:0045893	0.534	positive regulation of DNA-templated transcription
GO:0018130	0.393	heterocycle biosynthetic process
GO:0044271	0.349	cellular nitrogen compound biosynthetic process
GO:0009059	0.337	macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005737	0.999	cytoplasm
GO:0012505	0.974	endomembrane system
GO:0005654	0.935	nucleoplasm
GO:0005794	0.868	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]