StarFunc result for job id Q13613

User Input

>input (665 residues)
MDRPAAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQ
LIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKDVMYICPFM
GAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMR
NLRLAYKQEEQSKLGIFENLNKHAFPLSNGQALFAFSYKEKFPINGWKVYDPVSEYKRQG
LPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLSKVAAFRAKGRVPVLSWIHPESQA
TITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGYES
ESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLEYIRMLLAGA
VRIADKIESGKTSVVVHCSDGWDRTAQLTSLAMLMLDSYYRTIKGFETLVEKEWISFGHR
FALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLYSCLFGT
FLCNCEQQRFKEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY
YVRWNPRMRPQMPIHQNLKELLAVRAELQKRVEGLQREVATRAVSSSSERGSSPSHSATS
VHTSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Z2C4	0.933	0.928	0.000	669	0.931	0.925	Q9Z2C4.pdb.gz	MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus OX=10090 GN=Mtmr1 PE=1 SV=1
2	AFDB:Q13614	0.842	0.870	4.174E-91	643	0.656	0.678	Q13614.pdb.gz	MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens OX=9606 GN=MTMR2 PE=1 SV=4
3	AFDB:A0A024RC06	0.792	0.873	4.881E-79	603	0.508	0.561	A0A024RC06.pdb.gz
4	AFDB:F8W5H1	0.802	0.833	1.241E-78	639	0.520	0.541	F8W5H1.pdb.gz
5	PDB:1lw3A	0.761	0.984	4.549E-78	513	0.571	0.741	1lw3A.pdb.gz
6	AFDB:Q9VMI9	0.794	0.851	1.687E-73	619	0.484	0.520	Q9VMI9.pdb.gz	Q9VMI9_DROME Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Drosophila melanogaster OX=7227 GN=mtm PE=1 SV=1
7	AFDB:Q9N589	0.773	0.872	1.653E-60	588	0.361	0.408	Q9N589.pdb.gz	MTMR1_CAEEL Myotubularin-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=mtm-1 PE=1 SV=2
8	AFDB:Q6TEL0	0.745	0.783	3.001E-54	632	0.305	0.321	Q6TEL0.pdb.gz	MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio OX=7955 GN=mtmr8 PE=2 SV=1
9	AFDB:Q96EF0	0.735	0.695	1.465E-52	704	0.307	0.290	Q96EF0.pdb.gz	MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens OX=9606 GN=MTMR8 PE=1 SV=1
10	AFDB:Q8MLR7	0.750	0.657	1.051E-51	761	0.311	0.272	Q8MLR7.pdb.gz	Q8MLR7_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
11	AFDB:Q9Y217	0.737	0.787	3.462E-51	621	0.304	0.325	Q9Y217.pdb.gz	MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens OX=9606 GN=MTMR6 PE=1 SV=3
12	PDB:7nkyQ	0.124	0.191	2.120E-4	404	0.035	0.057	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
13	PDB:6xtbE	0.144	0.394	3.750E-4	235	0.024	0.068	6xtbE.pdb.gz
14	PDB:5yqrA	0.138	0.321	1.114E-3	268	0.024	0.060	5yqrA.pdb.gz
15	PDB:7mp5A	0.132	0.056	7.583E-3	1629	0.021	0.009	7mp5A.pdb.gz
16	PDB:7nkyO	0.109	0.165	1.488E-2	427	0.026	0.040	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
17	PDB:6upkH	0.101	0.159	1.650E-2	411	0.026	0.041	6upkH.pdb.gz	FACT caught in the act of manipulating the nucleosome.
18	PDB:2oz5A	0.189	0.410	1.738E-2	265	0.050	0.125	2oz5A.pdb.gz	Structural Basis for Selective Inhibition of Mycobacterium tuberculosis Protein Tyrosine Phosphatase PtpB.
19	PDB:3uzsA	0.143	0.154	2.771E-2	609	0.024	0.026	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
20	PDB:7r04B	0.133	0.047	3.592E-2	2229	0.066	0.020	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZA31	0.0	889	571	0.623	0.725	D3ZA31_RAT Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr2 PE=1 SV=2
2	Q13496	0.0	744	603	0.520	0.574	MTM1_HUMAN Myotubularin OS=Homo sapiens OX=9606 GN=MTM1 PE=1 SV=2
3	Q13613	0.0	1394	665	1.000	1.000	MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1 PE=1 SV=4
4	Q13614	0.0	924	643	0.662	0.684	MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens OX=9606 GN=MTMR2 PE=1 SV=4
5	Q32PM3	0.0	736	639	0.529	0.551	Q32PM3_DANRE Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Danio rerio OX=7955 GN=zgc:123266 PE=1 SV=1
6	Q9VMI9	0.0	648	619	0.465	0.499	Q9VMI9_DROME Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Drosophila melanogaster OX=7227 GN=mtm PE=1 SV=1
7	Q9Z2C4	0.0	1266	669	0.932	0.927	MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus OX=10090 GN=Mtmr1 PE=1 SV=1
8	Q9Z2C5	0.0	742	603	0.522	0.575	MTM1_MOUSE Myotubularin OS=Mus musculus OX=10090 GN=Mtm1 PE=1 SV=2
9	Q9Z2D1	0.0	910	643	0.639	0.661	MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus OX=10090 GN=Mtmr2 PE=1 SV=3
10	Q9N589	2.35e-154	460	588	0.353	0.400	MTMR1_CAEEL Myotubularin-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=mtm-1 PE=1 SV=2
11	Q6TEL0	2.01e-119	372	632	0.295	0.310	MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio OX=7955 GN=mtmr8 PE=2 SV=1
12	Q96EF0	1.05e-118	372	704	0.299	0.283	MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens OX=9606 GN=MTMR8 PE=1 SV=1
13	Q9Y217	1.57e-112	353	621	0.295	0.316	MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens OX=9606 GN=MTMR6 PE=1 SV=3
14	G5ED68	1.45e-108	345	676	0.284	0.280	MTMR6_CAEEL Myotubularin-related protein 6 OS=Caenorhabditis elegans OX=6239 GN=mtm-6 PE=1 SV=1
15	G5EBF2	4.08e-108	346	782	0.284	0.242	G5EBF2_CAEEL phosphatidylinositol-3-phosphatase OS=Caenorhabditis elegans OX=6239 GN=mtm-6 PE=1 SV=1
16	Q8MLR7	3.84e-107	343	761	0.305	0.267	Q8MLR7_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
17	Q7KK51	6.76e-107	339	639	0.278	0.290	Q7KK51_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
18	Q9W1Q6	1.00e-106	340	689	0.292	0.282	Q9W1Q6_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=2
19	Q96QG7	7.22e-104	328	549	0.290	0.352	MTMR9_HUMAN Myotubularin-related protein 9 OS=Homo sapiens OX=9606 GN=MTMR9 PE=1 SV=1
20	Q9Y216	8.78e-104	332	660	0.281	0.283	MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens OX=9606 GN=MTMR7 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12578 3-PAP	2.6e+02	12.8	Myotubularin-associated protein
2	PF00782 DSPc	12	17.1	Dual specificity phosphatase, catalytic domain
3	PF02893 GRAM	1.2e-05	36.6	GRAM domain
4	PF14379 Myb_CC_LHEQLE	53	15.0	MYB-CC type transfactor, LHEQLE motif
5	PF06602 Myotub-related	1.3e-142	486.7	Myotubularin-like phosphatase domain
6	PF00102 Y_phosphatase	12	16.9	Protein-tyrosine phosphatase
7	PF13350 Y_phosphatase3	63	15.0	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359417

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264380	0.955	1-phosphatidylinositol 3-phosphate 5-kinase
2	9606.ENSP00000230124	0.954	Polyphosphoinositide phosphatase
3	9606.ENSP00000219789	0.919	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
4	9606.ENSP00000265970	0.837	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
5	9606.ENSP00000356155	0.827	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
6	9606.ENSP00000262039	0.798	Phosphatidylinositol 3-kinase catalytic subunit type 3
7	9606.ENSP00000226798	0.783	Protein FRG1
8	9606.ENSP00000479921	0.783	annotation not available
9	9606.ENSP00000278317	0.772	Troponin T, fast skeletal muscle
10	9606.ENSP00000414517	0.764	Mastermind-like domain-containing protein 1
11	9606.ENSP00000365757	0.762	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
12	9606.ENSP00000445381	0.747	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
13	9606.ENSP00000373713	0.745	Phosphatidylinositide phosphatase SAC1
14	9606.ENSP00000357869	0.727	Phosphatidylinositol 4-kinase beta
15	9606.ENSP00000430344	0.725	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
16	9606.ENSP00000255882	0.720	Phosphatidylinositol 4-kinase alpha
17	9606.ENSP00000367762	0.709	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
18	9606.ENSP00000354519	0.707	Phosphatidylinositide phosphatase SAC2
19	9606.ENSP00000479636	0.694	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
20	9606.ENSP00000338185	0.683	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004438	1.000	phosphatidylinositol-3-phosphate phosphatase activity
GO:0106018	0.998	phosphatidylinositol-3,5-bisphosphate phosphatase activity
GO:0052629	0.639	phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0046486	0.996	glycerolipid metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0046488	0.987	phosphatidylinositol metabolic process
GO:0046474	0.968	glycerophospholipid biosynthetic process
GO:0016311	0.961	dephosphorylation
GO:0030258	0.961	lipid modification
GO:0006661	0.944	phosphatidylinositol biosynthetic process
GO:0019222	0.881	regulation of metabolic process
GO:0046839	0.875	phospholipid dephosphorylation
GO:0046856	0.845	phosphatidylinositol dephosphorylation
GO:0031323	0.838	regulation of cellular metabolic process
GO:0080090	0.678	regulation of primary metabolic process
GO:0019216	0.632	regulation of lipid metabolic process
GO:1903725	0.521	regulation of phospholipid metabolic process
GO:0035303	0.518	regulation of dephosphorylation
GO:0050896	0.333	response to stimulus
GO:0048518	0.319	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.975	plasma membrane
GO:0043229	0.819	intracellular organelle
GO:0043227	0.817	membrane-bounded organelle
GO:0043231	0.790	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12316	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate
EC:3.1.3.64	1.000	phosphatidylinositol-3-phosphatase.
RHEA:39019	0.639	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,5-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-5-phosphate) + phosphate
EC:3.1.3.95	0.639	phosphatidylinositol-3,5-bisphosphate 3-phosphatase.

[back to server]