StarFunc result for job id Q13614

User Input

>input (643 residues)
MEKSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPD
LRVLRESNKLAEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERD
PPFVLDASLGVINRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLM
KYAFPVSNNLPLFAFEYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYELCDTY
PALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATITRCSQPMVGVSGKRSKEDE
KYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDIHNIHVMR
ESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG
WDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVF
LQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSL
WSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKEL
LAKRAELQKKVEELQREISNRSTSSSERASSPAQCVTPVQTVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13614	1.000	1.000	0.000	643	1.000	1.000	Q13614.pdb.gz	MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens OX=9606 GN=MTMR2 PE=1 SV=4
2	PDB:1lw3A	0.796	0.997	9.200E-94	513	0.796	0.998	1lw3A.pdb.gz
3	AFDB:Q9Z2C4	0.871	0.837	2.900E-93	669	0.691	0.664	Q9Z2C4.pdb.gz	MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus OX=10090 GN=Mtmr1 PE=1 SV=1
4	AFDB:A0A024RC06	0.828	0.882	5.949E-85	603	0.600	0.640	A0A024RC06.pdb.gz
5	AFDB:F8W5H1	0.822	0.827	1.278E-82	639	0.588	0.592	F8W5H1.pdb.gz
6	AFDB:Q9VMI9	0.823	0.854	5.193E-80	619	0.541	0.562	Q9VMI9.pdb.gz	Q9VMI9_DROME Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Drosophila melanogaster OX=7227 GN=mtm PE=1 SV=1
7	AFDB:Q9N589	0.813	0.887	3.780E-64	588	0.393	0.430	Q9N589.pdb.gz	MTMR1_CAEEL Myotubularin-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=mtm-1 PE=1 SV=2
8	AFDB:Q6TEL0	0.769	0.782	1.106E-54	632	0.325	0.331	Q6TEL0.pdb.gz	MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio OX=7955 GN=mtmr8 PE=2 SV=1
9	AFDB:Q96EF0	0.744	0.682	2.456E-54	704	0.330	0.301	Q96EF0.pdb.gz	MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens OX=9606 GN=MTMR8 PE=1 SV=1
10	AFDB:Q8MLR7	0.768	0.652	6.064E-54	761	0.331	0.280	Q8MLR7.pdb.gz	Q8MLR7_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
11	AFDB:G5EBF2	0.778	0.644	8.342E-54	782	0.341	0.280	G5EBF2.pdb.gz	G5EBF2_CAEEL phosphatidylinositol-3-phosphatase OS=Caenorhabditis elegans OX=6239 GN=mtm-6 PE=1 SV=1
12	PDB:6xtbE	0.143	0.374	1.098E-4	235	0.033	0.089	6xtbE.pdb.gz
13	PDB:5yqrA	0.139	0.306	4.374E-4	268	0.031	0.075	5yqrA.pdb.gz
14	PDB:7mp5A	0.131	0.057	1.139E-3	1629	0.072	0.028	7mp5A.pdb.gz
15	PDB:2oz5A	0.203	0.420	1.838E-3	265	0.064	0.155	2oz5A.pdb.gz	Structural Basis for Selective Inhibition of Mycobacterium tuberculosis Protein Tyrosine Phosphatase PtpB.
16	PDB:3uzsA	0.140	0.146	3.127E-3	609	0.034	0.036	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
17	PDB:7r04B	0.135	0.047	3.668E-3	2229	0.086	0.025	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
18	PDB:1ywfA	0.143	0.329	4.785E-3	241	0.062	0.166	1ywfA.pdb.gz	Mycobacterium tuberculosis Protein Tyrosine Phosphatase PtpB Structure Reveals a Diverged Fold and a Buried Active Site.
19	PDB:4mk0A	0.152	0.155	5.612E-3	631	0.034	0.035	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:7nkyQ	0.125	0.187	6.942E-3	404	0.036	0.057	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZA31	0.0	1184	571	0.871	0.981	D3ZA31_RAT Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr2 PE=1 SV=2
2	Q13496	0.0	813	603	0.611	0.652	MTM1_HUMAN Myotubularin OS=Homo sapiens OX=9606 GN=MTM1 PE=1 SV=2
3	Q13613	0.0	936	665	0.669	0.647	MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1 PE=1 SV=4
4	Q13614	0.0	1341	643	1.000	1.000	MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens OX=9606 GN=MTMR2 PE=1 SV=4
5	Q32PM3	0.0	808	639	0.591	0.595	Q32PM3_DANRE Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Danio rerio OX=7955 GN=zgc:123266 PE=1 SV=1
6	Q9VMI9	0.0	724	619	0.530	0.551	Q9VMI9_DROME Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Drosophila melanogaster OX=7227 GN=mtm PE=1 SV=1
7	Q9Z2C4	0.0	939	669	0.686	0.659	MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus OX=10090 GN=Mtmr1 PE=1 SV=1
8	Q9Z2C5	0.0	822	603	0.599	0.638	MTM1_MOUSE Myotubularin OS=Mus musculus OX=10090 GN=Mtm1 PE=1 SV=2
9	Q9Z2D1	0.0	1310	643	0.974	0.974	MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus OX=10090 GN=Mtmr2 PE=1 SV=3
10	Q9N589	6.71e-166	489	588	0.389	0.425	MTMR1_CAEEL Myotubularin-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=mtm-1 PE=1 SV=2
11	Q96EF0	1.89e-126	391	704	0.309	0.283	MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens OX=9606 GN=MTMR8 PE=1 SV=1
12	Q6TEL0	5.31e-125	385	632	0.305	0.310	MTMR8_DANRE Myotubularin-related protein 8 OS=Danio rerio OX=7955 GN=mtmr8 PE=2 SV=1
13	Q9Y217	5.65e-122	377	621	0.320	0.332	MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens OX=9606 GN=MTMR6 PE=1 SV=3
14	Q7KK51	1.02e-120	374	639	0.305	0.307	Q7KK51_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
15	Q9W1Q6	5.96e-120	374	689	0.305	0.284	Q9W1Q6_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=2
16	Q8MLR7	7.04e-119	373	761	0.305	0.258	Q8MLR7_DROME Phosphatidylinositol-3-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Mtmr6 PE=1 SV=1
17	G5ED68	9.54e-119	370	676	0.309	0.294	MTMR6_CAEEL Myotubularin-related protein 6 OS=Caenorhabditis elegans OX=6239 GN=mtm-6 PE=1 SV=1
18	G5EBF2	7.59e-118	371	782	0.309	0.254	G5EBF2_CAEEL phosphatidylinositol-3-phosphatase OS=Caenorhabditis elegans OX=6239 GN=mtm-6 PE=1 SV=1
19	Q9Y216	4.42e-116	363	660	0.311	0.303	MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens OX=9606 GN=MTMR7 PE=1 SV=3
20	Q9Z2C9	4.97e-114	358	660	0.297	0.289	MTMR7_MOUSE Myotubularin-related protein 7 OS=Mus musculus OX=10090 GN=Mtmr7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12578 3-PAP	91	14.3	Myotubularin-associated protein
2	PF00782 DSPc	10	17.4	Dual specificity phosphatase, catalytic domain
3	PF02893 GRAM	1.1e-16	72.0	GRAM domain
4	PF06602 Myotub-related	4.8e-150	511.1	Myotubularin-like phosphatase domain
5	PF14775 NYD-SP28_assoc	46	15.5	Sperm tail C-terminal domain
6	PF00102 Y_phosphatase	0.7	21.0	Protein-tyrosine phosphatase
7	PF13350 Y_phosphatase3	1.4e+02	13.9	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345752

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230124	0.983	Polyphosphoinositide phosphatase
2	9606.ENSP00000264380	0.971	1-phosphatidylinositol 3-phosphate 5-kinase
3	9606.ENSP00000382428	0.969	Disks large homolog 4
4	9606.ENSP00000370196	0.963	Myotubularin-related protein 5
5	9606.ENSP00000482169	0.955	Neurofilament light polypeptide
6	9606.ENSP00000371577	0.930	Myotubularin-related protein 12
7	9606.ENSP00000219789	0.921	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
8	9606.ENSP00000262039	0.917	Phosphatidylinositol 3-kinase catalytic subunit type 3
9	9606.ENSP00000356155	0.876	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
10	9606.ENSP00000402537	0.873	Myotubularin-related protein 10
11	9606.ENSP00000423660	0.865	SH3 domain and tetratricopeptide repeats 2
12	9606.ENSP00000256190	0.864	Myotubularin-related protein 13
13	9606.ENSP00000265970	0.859	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
14	9606.ENSP00000345731	0.853	Disks large homolog 1
15	9606.ENSP00000362680	0.818	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000373713	0.800	Phosphatidylinositide phosphatase SAC1
17	9606.ENSP00000445381	0.781	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
18	9606.ENSP00000394487	0.769	FYVE, RhoGEF and PH domain-containing protein 4
19	9606.ENSP00000430344	0.764	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
20	9606.ENSP00000349205	0.761	Phosphoinositide 3-kinase regulatory subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004438	0.999	phosphatidylinositol-3-phosphate phosphatase activity
GO:0106018	0.995	phosphatidylinositol-3,5-bisphosphate phosphatase activity
GO:0052629	0.722	phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0006796	0.988	phosphate-containing compound metabolic process
GO:0046486	0.976	glycerolipid metabolic process
GO:0006644	0.976	phospholipid metabolic process
GO:0046488	0.973	phosphatidylinositol metabolic process
GO:0016311	0.967	dephosphorylation
GO:0046839	0.963	phospholipid dephosphorylation
GO:0008654	0.939	phospholipid biosynthetic process
GO:0046474	0.929	glycerophospholipid biosynthetic process
GO:0019222	0.927	regulation of metabolic process
GO:0006661	0.921	phosphatidylinositol biosynthetic process
GO:0031323	0.911	regulation of cellular metabolic process
GO:0046856	0.883	phosphatidylinositol dephosphorylation
GO:0080090	0.767	regulation of primary metabolic process
GO:0019220	0.700	regulation of phosphate metabolic process
GO:0071840	0.573	cellular component organization or biogenesis
GO:0019216	0.559	regulation of lipid metabolic process
GO:0016043	0.545	cellular component organization
GO:0035303	0.493	regulation of dephosphorylation
GO:0048518	0.453	positive regulation of biological process
GO:0060255	0.441	regulation of macromolecule metabolic process
GO:1903725	0.415	regulation of phospholipid metabolic process
GO:0048522	0.370	positive regulation of cellular process
GO:0032501	0.354	multicellular organismal process
GO:0050896	0.335	response to stimulus
GO:0006807	0.311	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.982	membrane
GO:0043226	0.968	organelle
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0005886	0.545	plasma membrane
GO:0031982	0.461	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12316	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate
EC:3.1.3.64	0.999	phosphatidylinositol-3-phosphatase.
RHEA:39019	0.722	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,5-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-5-phosphate) + phosphate
EC:3.1.3.95	0.722	phosphatidylinositol-3,5-bisphosphate 3-phosphatase.

[back to server]