StarFunc result for job id Q13615

User Input

>input (1198 residues)
MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEFVGRAEDAIIALSNYRL
HIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQEWLKRLNNAIRP
PAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISN
INEKYKLCGSYPQELIVPAWITDKELESVSSFRSWKRIPAVIYRHQSNGAVIARCGQPEV
SWWGWRNADDEHLVQSVAKACASDSRSSGSKLSTRNTSRDFPNGGDLSDVEFDSSLSNAS
GAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQ
SLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDQDQRPVLVHCSDGWDRT
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLL
RAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPTTPVDDSCAPYPAPGTSP
DDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDP
LSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKED
PLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQSGLSVLLSSLQ
VPPRGEDSLEVPVEQFRIEEIAEGREEAVLPIPVDAKVGYGTSQSCSLLPSQVPFETRGP
NVDSSTDMLVEDKVKSVSGPQGHHRSCLVNSGKDRLPQTMEPSPSETSLVERPQVGSVVH
RTSLGSTLSLTRSPCALPLAECKEGLVCNGAPETENRASEQPPGLSTLQMYPTPNGHCAN
GEAGRSKDSLSRQLSAMSCSSAHLHSRNLHHKWLHSHSGRPSATSSPDQPSRSHLDDDGM
SVYTDTIQQRLRQIESGHQQEVETLKKQVQELKSRLESQYLTSSLHFNGDFGDEVTSIPD
SESNLDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHCYACDSAFWLASRKHH
CRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIAATSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13615	1.000	1.000	0.000	1198	1.000	1.000	Q13615.pdb.gz	MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3 PE=1 SV=3
2	AFDB:Q9NYA4	0.541	0.542	0.000	1195	0.482	0.483	Q9NYA4.pdb.gz	MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens OX=9606 GN=MTMR4 PE=1 SV=2
3	PDB:1lw3A	0.377	0.860	2.569E-50	513	0.175	0.409	1lw3A.pdb.gz
4	AFDB:Q7Z3T8	0.059	0.048	6.327E-4	1539	0.083	0.064	Q7Z3T8.pdb.gz	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
5	PDB:5yqrA	0.051	0.213	4.709E-3	268	0.008	0.037	5yqrA.pdb.gz
6	PDB:7r04B	0.066	0.040	9.963E-3	2229	0.023	0.013	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
7	PDB:4mk0A	0.054	0.101	1.613E-2	631	0.013	0.025	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
8	AFDB:O13736	0.077	0.072	1.748E-2	1420	0.106	0.089	O13736.pdb.gz	SLA1_SCHPO Actin cytoskeleton-regulatory complex protein sla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sla1 PE=1 SV=1
9	PDB:6xtbE	0.068	0.318	1.795E-2	235	0.014	0.072	6xtbE.pdb.gz
10	PDB:2oz5A	0.077	0.286	1.894E-2	265	0.033	0.147	2oz5A.pdb.gz	Structural Basis for Selective Inhibition of Mycobacterium tuberculosis Protein Tyrosine Phosphatase PtpB.
11	PDB:3f81A	0.064	0.349	1.998E-2	179	0.017	0.112	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
12	PDB:1ywfA	0.060	0.227	2.755E-2	241	0.032	0.158	1ywfA.pdb.gz	Mycobacterium tuberculosis Protein Tyrosine Phosphatase PtpB Structure Reveals a Diverged Fold and a Buried Active Site.
13	PDB:3pvuA	0.065	0.124	2.906E-2	609	0.017	0.033	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
14	PDB:2q05A	0.075	0.401	3.600E-2	181	0.016	0.105	2q05A.pdb.gz
15	AFDB:Q9VTE2	0.060	0.071	4.582E-2	962	0.113	0.140	Q9VTE2.pdb.gz	SUUR_DROME Protein suppressor of underreplication OS=Drosophila melanogaster OX=7227 GN=SuUR PE=1 SV=3
16	AFDB:A0A0R4IC31	0.037	0.028	1.944E-1	1596	0.080	0.060	A0A0R4IC31.pdb.gz	A0A0R4IC31_DANRE A kinase (PRKA) anchor protein 12b OS=Danio rerio OX=7955 GN=akap12 PE=1 SV=1
17	AFDB:E9QHX3	0.064	0.062	2.283E-1	1246	0.098	0.094	E9QHX3.pdb.gz
18	AFDB:A0A0R4IKC9	0.060	0.058	3.148E-1	1268	0.115	0.109	A0A0R4IKC9.pdb.gz	A0A0R4IKC9_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
19	AFDB:E7F1U4	0.052	0.046	3.503E-1	1507	0.138	0.109	E7F1U4.pdb.gz	E7F1U4_DANRE Ras/Rap GTPase-activating protein SynGAP1b OS=Danio rerio OX=7955 GN=si:dkey-246f6.1 PE=1 SV=4
20	AFDB:A0A024R899	0.046	0.046	3.696E-1	1191	0.124	0.125	A0A024R899.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y8V2	0.0	791	1134	0.336	0.355	A0A8I5Y8V2_RAT Phosphatidylinositol-3-phosphate phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
2	A0A8I6A3Q2	0.0	909	1205	0.369	0.367	A0A8I6A3Q2_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
3	A0A8I6AFY1	0.0	909	1216	0.369	0.363	A0A8I6AFY1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
4	A0A8I6AT43	0.0	908	1195	0.369	0.370	A0A8I6AT43_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=1
5	D3ZW40	0.0	910	1191	0.370	0.372	D3ZW40_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr4 PE=3 SV=2
6	Q13615	0.0	2478	1198	1.000	1.000	MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens OX=9606 GN=MTMR3 PE=1 SV=3
7	Q9NYA4	0.0	1081	1195	0.505	0.506	MTMR4_HUMAN Myotubularin-related protein 4 OS=Homo sapiens OX=9606 GN=MTMR4 PE=1 SV=2
8	Q13614	3.55e-112	366	643	0.179	0.334	MTMR2_HUMAN Myotubularin-related protein 2 OS=Homo sapiens OX=9606 GN=MTMR2 PE=1 SV=4
9	Q9Z2D1	1.03e-110	362	643	0.177	0.330	MTMR2_MOUSE Myotubularin-related protein 2 OS=Mus musculus OX=10090 GN=Mtmr2 PE=1 SV=3
10	D3ZA31	5.16e-110	358	571	0.176	0.370	D3ZA31_RAT Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Rattus norvegicus OX=10116 GN=Mtmr2 PE=1 SV=2
11	Q13496	2.63e-105	347	603	0.164	0.327	MTM1_HUMAN Myotubularin OS=Homo sapiens OX=9606 GN=MTM1 PE=1 SV=2
12	Q9Z2C5	5.44e-105	346	603	0.168	0.333	MTM1_MOUSE Myotubularin OS=Mus musculus OX=10090 GN=Mtm1 PE=1 SV=2
13	Q32PM3	8.71e-104	343	639	0.166	0.311	Q32PM3_DANRE Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Danio rerio OX=7955 GN=zgc:123266 PE=1 SV=1
14	Q13613	2.11e-98	330	665	0.157	0.283	MTMR1_HUMAN Myotubularin-related protein 1 OS=Homo sapiens OX=9606 GN=MTMR1 PE=1 SV=4
15	Q9Z2C4	1.28e-96	325	669	0.155	0.278	MTMR1_MOUSE Myotubularin-related protein 1 OS=Mus musculus OX=10090 GN=Mtmr1 PE=1 SV=1
16	Q9VMI9	7.76e-95	318	619	0.160	0.310	Q9VMI9_DROME Phosphatidylinositol-3,5-bisphosphate 3-phosphatase OS=Drosophila melanogaster OX=7227 GN=mtm PE=1 SV=1
17	Q96EF0	5.05e-84	291	704	0.143	0.243	MTMR8_HUMAN Myotubularin-related protein 8 OS=Homo sapiens OX=9606 GN=MTMR8 PE=1 SV=1
18	Q9Y216	1.75e-83	288	660	0.145	0.264	MTMR7_HUMAN Myotubularin-related protein 7 OS=Homo sapiens OX=9606 GN=MTMR7 PE=1 SV=3
19	Q9Y217	2.26e-83	287	621	0.143	0.275	MTMR6_HUMAN Myotubularin-related protein 6 OS=Homo sapiens OX=9606 GN=MTMR6 PE=1 SV=3
20	Q9Z2C9	9.14e-82	283	660	0.142	0.258	MTMR7_MOUSE Myotubularin-related protein 7 OS=Mus musculus OX=10090 GN=Mtmr7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18504 Csm1_N	5e+02	12.5	Csm1 N-terminal domain
2	PF00782 DSPc	10	17.4	Dual specificity phosphatase, catalytic domain
3	PF01363 FYVE	1.3e-14	65.4	FYVE zinc finger
4	PF06602 Myotub-related	2.8e-134	459.2	Myotubularin-like phosphatase domain
5	PF00102 Y_phosphatase	2.6	19.1	Protein-tyrosine phosphatase
6	PF13350 Y_phosphatase3	7.1	18.1	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230124	0.936	Polyphosphoinositide phosphatase
2	9606.ENSP00000264380	0.931	1-phosphatidylinositol 3-phosphate 5-kinase
3	9606.ENSP00000325285	0.918	Myotubularin-related protein 4
4	9606.ENSP00000219789	0.917	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
5	9606.ENSP00000425487	0.915	Type II inositol 3,4-bisphosphate 4-phosphatase
6	9606.ENSP00000074304	0.910	Type I inositol 3,4-bisphosphate 4-phosphatase
7	9606.ENSP00000347032	0.905	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
8	9606.ENSP00000365757	0.903	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
9	9606.ENSP00000262039	0.828	Phosphatidylinositol 3-kinase catalytic subunit type 3
10	9606.ENSP00000265970	0.765	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
11	9606.ENSP00000356155	0.764	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
12	9606.ENSP00000373713	0.761	Phosphatidylinositide phosphatase SAC1
13	9606.ENSP00000445381	0.761	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
14	9606.ENSP00000482457	0.756	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
15	9606.ENSP00000367762	0.742	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
16	9606.ENSP00000388631	0.727	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
17	9606.ENSP00000428056	0.727	Phosphatidylinositol 3-kinase regulatory subunit alpha
18	9606.ENSP00000255882	0.726	Phosphatidylinositol 4-kinase alpha
19	9606.ENSP00000244007	0.712	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
20	9606.ENSP00000354519	0.702	Phosphatidylinositide phosphatase SAC2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019903	1.000	protein phosphatase binding
GO:0106018	1.000	phosphatidylinositol-3,5-bisphosphate phosphatase activity
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0004722	1.000	protein serine/threonine phosphatase activity
GO:0004438	1.000	phosphatidylinositol-3-phosphate phosphatase activity
GO:0008138	0.996	protein tyrosine/serine/threonine phosphatase activity
GO:0052629	0.947	phosphatidylinositol-3,5-bisphosphate 3-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0050789	0.986	regulation of biological process
GO:0006793	0.955	phosphorus metabolic process
GO:0050794	0.953	regulation of cellular process
GO:0050896	0.933	response to stimulus
GO:0046488	0.926	phosphatidylinositol metabolic process
GO:0006661	0.911	phosphatidylinositol biosynthetic process
GO:0019222	0.901	regulation of metabolic process
GO:0031323	0.862	regulation of cellular metabolic process
GO:0051716	0.688	cellular response to stimulus
GO:0006807	0.642	nitrogen compound metabolic process
GO:0007154	0.637	cell communication
GO:0080090	0.637	regulation of primary metabolic process
GO:0043170	0.619	macromolecule metabolic process
GO:1901564	0.524	organonitrogen compound metabolic process
GO:0016311	0.410	dephosphorylation
GO:0019538	0.394	protein metabolic process
GO:0060255	0.328	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0012505	0.857	endomembrane system
GO:0031982	0.787	vesicle
GO:0019898	0.758	extrinsic component of membrane
GO:0031090	0.688	organelle membrane
GO:0098588	0.623	bounding membrane of organelle
GO:0097708	0.596	intracellular vesicle
GO:0005768	0.551	endosome
GO:0005769	0.370	early endosome
GO:0010008	0.330	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12316	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.64	1.000	phosphatidylinositol-3-phosphatase.
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.
EC:3.1.3.16	1.000	protein-serine/threonine phosphatase.
RHEA:39019	0.947	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,5-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-5-phosphate) + phosphate
EC:3.1.3.95	0.947	phosphatidylinositol-3,5-bisphosphate 3-phosphatase.

[back to server]