StarFunc result for job id Q13618

User Input

>input (768 residues)
MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRN
AYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIR
DILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR
GAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEAR
INEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMY
KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESF
NNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFR
FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSIS
NTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYL
AKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMT
ILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFT
VNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHN
VLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DF89	0.950	0.950	7.357E-102	768	0.996	0.996	B5DF89.pdb.gz	CUL3_RAT Cullin-3 OS=Rattus norvegicus OX=10116 GN=Cul3 PE=1 SV=2
2	AFDB:Q8IP45	0.944	0.778	1.573E-80	934	0.685	0.563	Q8IP45.pdb.gz	Q8IP45_DROME Cullin 3, isoform F OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=2
3	AFDB:Q17391	0.914	0.904	1.652E-66	777	0.491	0.485	Q17391.pdb.gz	CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans OX=6239 GN=cul-3 PE=1 SV=2
4	AFDB:Q9ZVH4	0.851	0.891	3.635E-65	732	0.516	0.541	Q9ZVH4.pdb.gz	CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana OX=3702 GN=CUL3A PE=1 SV=1
5	AFDB:Q9C9L0	0.885	0.927	3.247E-64	732	0.513	0.538	Q9C9L0.pdb.gz	CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana OX=3702 GN=CUL3B PE=1 SV=1
6	AFDB:Q13619	0.746	0.753	9.929E-53	759	0.382	0.386	Q13619.pdb.gz	CUL4A_HUMAN Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3
7	AFDB:Q09760	0.845	0.828	1.973E-52	785	0.392	0.383	Q09760.pdb.gz	CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cul3 PE=1 SV=2
8	AFDB:Q5BI50	0.739	0.696	2.060E-52	821	0.371	0.347	Q5BI50.pdb.gz	Q5BI50_DROME Cullin 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cul4 PE=1 SV=1
9	AFDB:Q8LGH4	0.781	0.759	2.093E-51	792	0.387	0.375	Q8LGH4.pdb.gz	CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana OX=3702 GN=CUL4 PE=1 SV=1
10	AFDB:D3ZK73	0.744	0.603	6.390E-51	971	0.375	0.297	D3ZK73.pdb.gz	D3ZK73_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
11	PDB:4a0kA	0.710	0.752	7.829E-44	719	0.379	0.405	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
12	PDB:1ldjA	0.795	0.839	7.774E-39	725	0.314	0.332	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
13	PDB:6ttuC	0.659	0.715	3.361E-35	701	0.311	0.341	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
14	PDB:6v9iC	0.823	0.863	4.813E-34	730	0.247	0.260	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
15	PDB:5n4wA	0.606	0.679	3.652E-27	671	0.249	0.285	5n4wA.pdb.gz	Crystal Structure of the Cul2-Rbx1-EloBC-VHL Ubiquitin Ligase Complex.
16	PDB:6r6hO	0.645	0.661	8.521E-25	745	0.266	0.274	6r6hO.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
17	PDB:5lcwN	0.363	0.393	1.029E-12	703	0.143	0.156	5lcwN.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
18	PDB:7qe7N	0.347	0.385	2.647E-12	682	0.132	0.148	7qe7N.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:6tm5N	0.344	0.385	3.193E-11	676	0.137	0.155	6tm5N.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
20	PDB:5khrN	0.377	0.434	4.502E-11	645	0.148	0.177	5khrN.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DF89	0.0	1593	768	0.996	0.996	CUL3_RAT Cullin-3 OS=Rattus norvegicus OX=10116 GN=Cul3 PE=1 SV=2
2	Q13618	0.0	1601	768	1.000	1.000	CUL3_HUMAN Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3 PE=1 SV=2
3	Q17391	0.0	739	777	0.493	0.488	CUL3_CAEEL Cullin-3 OS=Caenorhabditis elegans OX=6239 GN=cul-3 PE=1 SV=2
4	Q8IP45	0.0	1080	934	0.686	0.564	Q8IP45_DROME Cullin 3, isoform F OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=2
5	Q9C9L0	0.0	757	732	0.513	0.538	CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana OX=3702 GN=CUL3B PE=1 SV=1
6	Q9JLV5	0.0	1591	768	0.995	0.995	CUL3_MOUSE Cullin-3 OS=Mus musculus OX=10090 GN=Cul3 PE=1 SV=1
7	Q9V475	0.0	1098	773	0.695	0.691	Q9V475_DROME Cullin 3, isoform C OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=1
8	Q9ZVH4	0.0	775	732	0.518	0.544	CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana OX=3702 GN=CUL3A PE=1 SV=1
9	Q13619	1.02e-167	504	759	0.389	0.394	CUL4A_HUMAN Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3
10	A0A8I6B5A8	1.87e-166	505	897	0.376	0.322	A0A8I6B5A8_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
11	D3ZK73	1.98e-165	505	971	0.376	0.298	D3ZK73_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
12	Q3TCH7	4.06e-165	497	759	0.392	0.397	CUL4A_MOUSE Cullin-4A OS=Mus musculus OX=10090 GN=Cul4a PE=1 SV=1
13	Q8LGH4	6.26e-165	498	792	0.388	0.376	CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana OX=3702 GN=CUL4 PE=1 SV=1
14	Q5BI50	2.23e-163	495	821	0.378	0.353	Q5BI50_DROME Cullin 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cul4 PE=1 SV=1
15	K4DI93	4.15e-162	494	900	0.374	0.319	K4DI93_HUMAN Cullin 4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=1
16	Q13620	4.44e-162	494	913	0.374	0.314	CUL4B_HUMAN Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=4
17	A2A432	1.67e-160	492	970	0.372	0.295	CUL4B_MOUSE Cullin-4B OS=Mus musculus OX=10090 GN=Cul4b PE=1 SV=1
18	A0A669KAX4	4.05e-160	489	897	0.374	0.320	A0A669KAX4_HUMAN Cullin 4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=1
19	Q09760	1.04e-159	484	785	0.396	0.387	CUL3_SCHPO Cullin-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cul3 PE=1 SV=2
20	Q961E0	8.65e-143	434	601	0.327	0.418	Q961E0_DROME GM14815p OS=Drosophila melanogaster OX=7227 GN=Cul4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00888 Cullin	4e-228	770.8	Cullin family
2	PF10557 Cullin_Nedd8	2.1e-23	93.5	Cullin protein neddylation domain
3	PF20360 DUF6655	4e+02	11.6	Family of unknown function (DUF6655)
4	PF12363 Phage_TAC_12	2e+02	13.8	Phage tail assembly chaperone protein, TAC
5	PF09284 RhgB_N	1.2e+02	13.6	Rhamnogalacturonan lyase B, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000003972

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000012347	0.997	Speckle-type POZ protein-like
2	60711.ENSCSAP00000002157	0.994	Ring-box 1, E3 ubiquitin protein ligase
3	60711.ENSCSAP00000003384	0.994	Kelch-like ECH-associated protein 1
4	60711.ENSCSAP00000009497	0.991	Kelch-like family member 3
5	60711.ENSCSAP00000018574	0.987	Neural precursor cell expressed, developmentally down-regulated 8
6	60711.ENSCSAP00000015001	0.984	Kelch-like family member 11
7	60711.ENSCSAP00000010361	0.978	Kelch-like family member 12
8	60711.ENSCSAP00000000696	0.972	Cullin-associated and neddylation-dissociated 1
9	60711.ENSCSAP00000016441	0.963	Ubiquitin-conjugating enzyme E2M
10	60711.ENSCSAP00000015874	0.961	G protein pathway suppressor 1
11	60711.ENSCSAP00000007987	0.959	Kelch-like family member 20
12	60711.ENSCSAP00000014285	0.959	Kelch-like family member 13
13	60711.ENSCSAP00000014867	0.959	Kelch-like family member 2
14	60711.ENSCSAP00000010231	0.956	COP9 signalosome subunit 5
15	60711.ENSCSAP00000008332	0.955	Potassium channel tetramerization domain containing 6
16	60711.ENSCSAP00000009793	0.943	Belongs to the SKP1 family.
17	60711.ENSCSAP00000009382	0.942	DCN1-like protein
18	60711.ENSCSAP00000008545	0.941	Kelch-like family member 22
19	60711.ENSCSAP00000012714	0.941	GLI family zinc finger 2
20	60711.ENSCSAP00000001725	0.939	Negative regulator in the hedgehog signaling pathway. Down- regulates GLI1-mediated transactivation of target genes. Part of a corepressor complex that acts on DNA-bound GLI1. May also act by linking GLI1 to BTRC and thereby targeting GLI1 to degradation by the proteasome. Sequesters GLI1, GLI2 and GLI3 in the cytoplasm, this effect is overcome by binding of STK36 to both SUFU and a GLI protein. Negative regulator of beta-catenin signaling. Regulates the formation of either the repressor form (GLI3R) or the activator form (GLI3A) of the full-length form of GLI3 (GLI3FL). GLI3FL is comp [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.664	enzyme binding
GO:0140096	0.435	catalytic activity, acting on a protein
GO:0016740	0.412	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0009987	0.987	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0044238	0.978	primary metabolic process
GO:0050896	0.977	response to stimulus
GO:0006807	0.973	nitrogen compound metabolic process
GO:1901564	0.918	organonitrogen compound metabolic process
GO:0019538	0.908	protein metabolic process
GO:0023052	0.876	signaling
GO:0044237	0.844	cellular metabolic process
GO:0051716	0.842	cellular response to stimulus
GO:0019222	0.815	regulation of metabolic process
GO:0007154	0.811	cell communication
GO:0060255	0.792	regulation of macromolecule metabolic process
GO:0051171	0.792	regulation of nitrogen compound metabolic process
GO:0006508	0.790	proteolysis
GO:0080090	0.783	regulation of primary metabolic process
GO:0051603	0.783	proteolysis involved in protein catabolic process
GO:0043412	0.763	macromolecule modification
GO:0044265	0.747	cellular macromolecule catabolic process
GO:0032446	0.743	protein modification by small protein conjugation
GO:0016567	0.710	protein ubiquitination
GO:0006511	0.692	ubiquitin-dependent protein catabolic process
GO:0048518	0.581	positive regulation of biological process
GO:0048519	0.545	negative regulation of biological process
GO:0071840	0.489	cellular component organization or biogenesis
GO:0048522	0.419	positive regulation of cellular process
GO:0032502	0.408	developmental process
GO:0006950	0.395	response to stress
GO:0051246	0.393	regulation of protein metabolic process
GO:0010604	0.393	positive regulation of macromolecule metabolic process
GO:0007165	0.386	signal transduction
GO:0051173	0.384	positive regulation of nitrogen compound metabolic process
GO:0010498	0.382	proteasomal protein catabolic process
GO:0048856	0.380	anatomical structure development
GO:0043161	0.368	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0048523	0.340	negative regulation of cellular process
GO:0032501	0.334	multicellular organismal process
GO:0016043	0.332	cellular component organization
GO:0000209	0.322	protein polyubiquitination
GO:0031323	0.309	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0000151	0.998	ubiquitin ligase complex
GO:0031461	0.983	cullin-RING ubiquitin ligase complex
GO:0005829	0.982	cytosol
GO:0043228	0.970	non-membrane-bounded organelle
GO:0043232	0.924	intracellular non-membrane-bounded organelle
GO:0012505	0.766	endomembrane system
GO:0031463	0.344	Cul3-RING ubiquitin ligase complex
GO:0031982	0.330	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.412	Transferases.

[back to server]