StarFunc result for job id Q13619

User Input

>input (759 residues)
MADEAPRKGSFSALVGRTNGLTKPAALAAAPAKPGGAGGSKKLVIKNFRDRPRLPDNYTQ
DTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDHVQAQILP
FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSTLPSIWDMGLELFRT
HIISDKMVQSKTIDGILLLIERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETN
CLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLDHLLDENRVPDLAQMYQLFSRVRGGQQALLQHWSEYIKTFGTAIVINPEKDKD
MVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELIAKHVDSKLRAG
NKEATDEELERTLDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPME
VHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLL
MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13619	1.000	1.000	9.403E-103	759	1.000	1.000	Q13619.pdb.gz	CUL4A_HUMAN Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3
2	AFDB:D3ZK73	0.959	0.751	2.453E-88	971	0.812	0.634	D3ZK73.pdb.gz	D3ZK73_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
3	PDB:4a0kA	0.930	0.981	1.882E-81	719	0.947	1.000	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
4	AFDB:Q5BI50	0.953	0.882	2.757E-77	821	0.648	0.599	Q5BI50.pdb.gz	Q5BI50_DROME Cullin 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cul4 PE=1 SV=1
5	AFDB:Q8LGH4	0.939	0.901	4.850E-71	792	0.561	0.538	Q8LGH4.pdb.gz	CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana OX=3702 GN=CUL4 PE=1 SV=1
6	AFDB:B2GSS7	0.804	0.960	8.315E-70	635	0.656	0.784	B2GSS7.pdb.gz
7	AFDB:Q54CS2	0.914	0.866	7.369E-60	802	0.472	0.446	Q54CS2.pdb.gz	CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum OX=44689 GN=culD PE=3 SV=1
8	AFDB:Q9ZVH4	0.844	0.873	2.472E-53	732	0.374	0.388	Q9ZVH4.pdb.gz	CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana OX=3702 GN=CUL3A PE=1 SV=1
9	AFDB:B5DF89	0.728	0.721	1.165E-52	768	0.386	0.382	B5DF89.pdb.gz	CUL3_RAT Cullin-3 OS=Rattus norvegicus OX=10116 GN=Cul3 PE=1 SV=2
10	AFDB:Q9C9L0	0.810	0.838	1.384E-52	732	0.372	0.385	Q9C9L0.pdb.gz	CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana OX=3702 GN=CUL3B PE=1 SV=1
11	AFDB:Q8IP45	0.721	0.602	2.947E-49	934	0.374	0.304	Q8IP45.pdb.gz	Q8IP45_DROME Cullin 3, isoform F OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=2
12	PDB:1ldjA	0.768	0.800	1.118E-35	725	0.310	0.324	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
13	PDB:6ttuC	0.585	0.623	7.758E-35	701	0.307	0.332	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
14	PDB:6v9iC	0.712	0.737	1.389E-33	730	0.256	0.266	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
15	PDB:5n4wA	0.572	0.629	7.019E-26	671	0.252	0.285	5n4wA.pdb.gz	Crystal Structure of the Cul2-Rbx1-EloBC-VHL Ubiquitin Ligase Complex.
16	PDB:6r6hO	0.632	0.642	1.058E-24	745	0.257	0.262	6r6hO.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
17	PDB:5lcwN	0.398	0.424	1.474E-13	703	0.149	0.161	5lcwN.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
18	PDB:5khrN	0.390	0.445	1.828E-13	645	0.146	0.172	5khrN.pdb.gz
19	PDB:7z8bC	0.407	0.286	8.613E-13	1224	0.169	0.105	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
20	PDB:7qe7N	0.353	0.388	8.992E-13	682	0.153	0.170	7qe7N.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A669KAX4	0.0	1258	897	0.818	0.692	A0A669KAX4_HUMAN Cullin 4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=1
2	A0A8I6B5A8	0.0	1295	897	0.818	0.692	A0A8I6B5A8_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
3	A2A432	0.0	1262	970	0.817	0.639	CUL4B_MOUSE Cullin-4B OS=Mus musculus OX=10090 GN=Cul4b PE=1 SV=1
4	D3ZK73	0.0	1298	971	0.818	0.640	D3ZK73_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
5	K4DI93	0.0	1264	900	0.818	0.690	K4DI93_HUMAN Cullin 4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=1
6	Q13619	0.0	1575	759	1.000	1.000	CUL4A_HUMAN Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3
7	Q13620	0.0	1263	913	0.818	0.680	CUL4B_HUMAN Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=4
8	Q3TCH7	0.0	1479	759	0.951	0.951	CUL4A_MOUSE Cullin-4A OS=Mus musculus OX=10090 GN=Cul4a PE=1 SV=1
9	Q54CS2	0.0	683	802	0.470	0.445	CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum OX=44689 GN=culD PE=3 SV=1
10	Q5BI50	0.0	993	821	0.651	0.602	Q5BI50_DROME Cullin 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cul4 PE=1 SV=1
11	Q7T2C1	0.0	1033	635	0.652	0.780	Q7T2C1_DANRE Cullin-4A OS=Danio rerio OX=7955 GN=zgc:64071 PE=1 SV=1
12	Q8LGH4	0.0	842	792	0.560	0.537	CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana OX=3702 GN=CUL4 PE=1 SV=1
13	Q961E0	0.0	820	601	0.530	0.669	Q961E0_DROME GM14815p OS=Drosophila melanogaster OX=7227 GN=Cul4 PE=2 SV=1
14	B5DF89	1.31e-169	509	768	0.402	0.397	CUL3_RAT Cullin-3 OS=Rattus norvegicus OX=10116 GN=Cul3 PE=1 SV=2
15	Q9JLV5	4.15e-169	508	768	0.403	0.398	CUL3_MOUSE Cullin-3 OS=Mus musculus OX=10090 GN=Cul3 PE=1 SV=1
16	Q9C9L0	5.41e-169	506	732	0.375	0.389	CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana OX=3702 GN=CUL3B PE=1 SV=1
17	Q13618	1.58e-168	506	768	0.402	0.397	CUL3_HUMAN Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3 PE=1 SV=2
18	Q9ZVH4	1.79e-168	504	732	0.378	0.392	CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana OX=3702 GN=CUL3A PE=1 SV=1
19	Q9V475	2.33e-149	457	773	0.368	0.361	Q9V475_DROME Cullin 3, isoform C OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=1
20	Q8IP45	7.52e-148	457	934	0.368	0.299	Q8IP45_DROME Cullin 3, isoform F OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00888 Cullin	2.5e-207	702.1	Cullin family
2	PF10557 Cullin_Nedd8	3e-19	80.2	Cullin protein neddylation domain
3	PF07516 SecA_SW	1.1e+02	14.3	SecA Wing and Scaffold domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364589

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216225	0.999	E3 ubiquitin-protein ligase RBX1
2	9606.ENSP00000231948	0.999	Protein cereblon
3	9606.ENSP00000256996	0.999	DNA damage-binding protein 2
4	9606.ENSP00000301764	0.999	DNA damage-binding protein 1
5	9606.ENSP00000355958	0.999	Denticleless protein homolog
6	9606.ENSP00000393183	0.999	DDB1- and CUL4-associated factor 1
7	9606.ENSP00000456340	0.999	DET1 homolog
8	9606.ENSP00000250495	0.998	NEDD8
9	9606.ENSP00000415556	0.998	DDB1- and CUL4-associated factor 11
10	9606.ENSP00000265038	0.996	DNA excision repair protein ERCC-8
11	9606.ENSP00000352928	0.994	DET1- and DDB1-associated protein 1
12	9606.ENSP00000351147	0.992	DDB1- and CUL4-associated factor 4
13	9606.ENSP00000442318	0.991	Cullin-associated NEDD8-dissociated protein 1
14	9606.ENSP00000313034	0.990	F-box/WD repeat-containing protein 5
15	9606.ENSP00000350512	0.990	COP9 signalosome complex subunit 5
16	9606.ENSP00000356814	0.990	DDB1- and CUL4-associated factor 6
17	9606.ENSP00000228872	0.988	Cyclin-dependent kinase inhibitor 1B
18	9606.ENSP00000299259	0.987	COP9 signalosome complex subunit 2
19	9606.ENSP00000356641	0.987	E3 ubiquitin-protein ligase RFWD2
20	9606.ENSP00000304102	0.986	COP9 signalosome complex subunit 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0050789	0.985	regulation of biological process
GO:0043170	0.981	macromolecule metabolic process
GO:0050794	0.974	regulation of cellular process
GO:0006807	0.966	nitrogen compound metabolic process
GO:0050896	0.965	response to stimulus
GO:0019538	0.929	protein metabolic process
GO:0044237	0.898	cellular metabolic process
GO:0071840	0.881	cellular component organization or biogenesis
GO:0051716	0.862	cellular response to stimulus
GO:1901565	0.791	organonitrogen compound catabolic process
GO:0044260	0.767	cellular macromolecule metabolic process
GO:0009314	0.722	response to radiation
GO:0009057	0.690	macromolecule catabolic process
GO:0019222	0.684	regulation of metabolic process
GO:0048518	0.645	positive regulation of biological process
GO:0043412	0.634	macromolecule modification
GO:0060255	0.624	regulation of macromolecule metabolic process
GO:0036211	0.619	protein modification process
GO:0080090	0.614	regulation of primary metabolic process
GO:0051171	0.568	regulation of nitrogen compound metabolic process
GO:0070647	0.552	protein modification by small protein conjugation or removal
GO:0016567	0.510	protein ubiquitination
GO:0009416	0.508	response to light stimulus
GO:0006950	0.466	response to stress
GO:0030163	0.462	protein catabolic process
GO:0006508	0.444	proteolysis
GO:0048522	0.439	positive regulation of cellular process
GO:0016043	0.434	cellular component organization
GO:0033554	0.429	cellular response to stress
GO:0031323	0.410	regulation of cellular metabolic process
GO:0048519	0.399	negative regulation of biological process
GO:0048523	0.383	negative regulation of cellular process
GO:0006974	0.381	cellular response to DNA damage stimulus
GO:0090304	0.369	nucleic acid metabolic process
GO:0009411	0.351	response to UV
GO:0009893	0.339	positive regulation of metabolic process
GO:0032502	0.328	developmental process
GO:0051173	0.328	positive regulation of nitrogen compound metabolic process
GO:0048856	0.314	anatomical structure development
GO:0010604	0.311	positive regulation of macromolecule metabolic process
GO:0051603	0.307	proteolysis involved in protein catabolic process
GO:0032501	0.303	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0000151	0.995	ubiquitin ligase complex
GO:0031461	0.983	cullin-RING ubiquitin ligase complex
GO:0005737	0.949	cytoplasm
GO:0005829	0.922	cytosol
GO:0080008	0.877	Cul4-RING E3 ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]