StarFunc result for job id Q13620

User Input

>input (913 residues)
MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLN
SSSSSSSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVAASSHVPIQKKLR
FEDTLEFVGFDAKMAEESSSSSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSS
TTVSSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEEL
YQAVENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQM
IMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGILLLIERERNG
EAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKR
LEEEADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLF
SRVRGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKF
INAMKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGK
DVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMI
QFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRK
LQWQSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRR
TLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTE
RVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME
RDKENPNQYNYIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13619	0.807	0.969	9.370E-90	759	0.680	0.818	Q13619.pdb.gz	CUL4A_HUMAN Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3
2	PDB:4a0kA	0.772	0.977	3.028E-74	719	0.667	0.847	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
3	AFDB:Q8LGH4	0.780	0.897	1.104E-73	792	0.475	0.548	Q8LGH4.pdb.gz	CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana OX=3702 GN=CUL4 PE=1 SV=1
4	AFDB:B2GSS7	0.673	0.965	1.186E-70	635	0.540	0.776	B2GSS7.pdb.gz
5	AFDB:Q54CS2	0.758	0.861	1.036E-61	802	0.406	0.463	Q54CS2.pdb.gz	CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum OX=44689 GN=culD PE=3 SV=1
6	AFDB:O13790	0.663	0.777	1.674E-41	767	0.244	0.291	O13790.pdb.gz	CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cul1 PE=1 SV=1
7	AFDB:Q17389	0.610	0.698	1.410E-39	780	0.230	0.269	Q17389.pdb.gz	CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans OX=6239 GN=cul-1 PE=1 SV=1
8	PDB:1ldjA	0.638	0.783	3.993E-35	725	0.252	0.317	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
9	PDB:6ttuC	0.489	0.604	1.557E-34	701	0.248	0.322	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
10	PDB:6v9iC	0.598	0.725	3.008E-34	730	0.214	0.267	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
11	PDB:5n4wA	0.478	0.605	1.045E-25	671	0.215	0.292	5n4wA.pdb.gz	Crystal Structure of the Cul2-Rbx1-EloBC-VHL Ubiquitin Ligase Complex.
12	PDB:6r6hO	0.537	0.633	3.823E-24	745	0.225	0.275	6r6hO.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
13	PDB:5lcwN	0.323	0.406	5.542E-14	703	0.125	0.162	5lcwN.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
14	PDB:7qe7N	0.323	0.414	5.433E-13	682	0.122	0.163	7qe7N.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:5khrN	0.357	0.473	8.427E-13	645	0.128	0.181	5khrN.pdb.gz
16	PDB:6tm5N	0.302	0.387	5.565E-12	676	0.129	0.175	6tm5N.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
17	AFDB:F4IKX0	0.100	0.088	5.061E-4	1108	0.117	0.097	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
18	AFDB:Q14669	0.105	0.059	3.061E-3	1992	0.135	0.062	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
19	AFDB:G5E870	0.093	0.059	7.364E-3	2025	0.117	0.053	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
20	AFDB:F1RBK4	0.124	0.101	1.423E-2	1216	0.113	0.085	F1RBK4.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A669KAX4	0.0	1838	897	0.976	0.993	A0A669KAX4_HUMAN Cullin 4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=1
2	A0A8I6B5A8	0.0	1795	897	0.962	0.979	A0A8I6B5A8_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
3	A2A432	0.0	1784	970	0.955	0.899	CUL4B_MOUSE Cullin-4B OS=Mus musculus OX=10090 GN=Cul4b PE=1 SV=1
4	D3ZK73	0.0	1793	971	0.962	0.904	D3ZK73_RAT Cullin 4B OS=Rattus norvegicus OX=10116 GN=Cul4b PE=1 SV=1
5	K4DI93	0.0	1844	900	0.976	0.990	K4DI93_HUMAN Cullin 4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=1
6	Q13619	0.0	1291	759	0.667	0.802	CUL4A_HUMAN Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3
7	Q13620	0.0	1890	913	1.000	1.000	CUL4B_HUMAN Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=4
8	Q3TCH7	0.0	1273	759	0.679	0.817	CUL4A_MOUSE Cullin-4A OS=Mus musculus OX=10090 GN=Cul4a PE=1 SV=1
9	Q54CS2	0.0	697	802	0.401	0.456	CUL4_DICDI Cullin-4 OS=Dictyostelium discoideum OX=44689 GN=culD PE=3 SV=1
10	Q5BI50	0.0	1019	821	0.545	0.607	Q5BI50_DROME Cullin 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cul4 PE=1 SV=1
11	Q7T2C1	0.0	1057	635	0.541	0.778	Q7T2C1_DANRE Cullin-4A OS=Danio rerio OX=7955 GN=zgc:64071 PE=1 SV=1
12	Q8LGH4	0.0	865	792	0.468	0.539	CUL4_ARATH Cullin-4 OS=Arabidopsis thaliana OX=3702 GN=CUL4 PE=1 SV=1
13	Q961E0	0.0	829	601	0.442	0.672	Q961E0_DROME GM14815p OS=Drosophila melanogaster OX=7227 GN=Cul4 PE=2 SV=1
14	Q9ZVH4	6.96e-176	529	732	0.320	0.399	CUL3A_ARATH Cullin-3A OS=Arabidopsis thaliana OX=3702 GN=CUL3A PE=1 SV=1
15	Q9C9L0	3.22e-174	525	732	0.313	0.391	CUL3B_ARATH Cullin-3B OS=Arabidopsis thaliana OX=3702 GN=CUL3B PE=1 SV=1
16	B5DF89	7.41e-168	509	768	0.318	0.378	CUL3_RAT Cullin-3 OS=Rattus norvegicus OX=10116 GN=Cul3 PE=1 SV=2
17	Q13618	9.90e-168	509	768	0.318	0.378	CUL3_HUMAN Cullin-3 OS=Homo sapiens OX=9606 GN=CUL3 PE=1 SV=2
18	Q9JLV5	1.92e-167	508	768	0.318	0.378	CUL3_MOUSE Cullin-3 OS=Mus musculus OX=10090 GN=Cul3 PE=1 SV=1
19	Q9V475	2.13e-160	490	773	0.321	0.379	Q9V475_DROME Cullin 3, isoform C OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=1
20	Q8IP45	4.94e-159	492	934	0.317	0.309	Q8IP45_DROME Cullin 3, isoform F OS=Drosophila melanogaster OX=7227 GN=Cul3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00888 Cullin	1.2e-206	699.8	Cullin family
2	PF10557 Cullin_Nedd8	3.2e-21	86.5	Cullin protein neddylation domain
3	PF07516 SecA_SW	2.3	19.7	SecA Wing and Scaffold domain
4	PF10273 WGG	4.6e+02	12.7	Pre-rRNA-processing protein TSR2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216225	0.999	E3 ubiquitin-protein ligase RBX1
2	9606.ENSP00000301764	0.999	DNA damage-binding protein 1
3	9606.ENSP00000355958	0.998	Denticleless protein homolog
4	9606.ENSP00000442318	0.998	Cullin-associated NEDD8-dissociated protein 1
5	9606.ENSP00000256996	0.997	DNA damage-binding protein 2
6	9606.ENSP00000350512	0.994	COP9 signalosome complex subunit 5
7	9606.ENSP00000415556	0.994	DDB1- and CUL4-associated factor 11
8	9606.ENSP00000351147	0.992	DDB1- and CUL4-associated factor 4
9	9606.ENSP00000393183	0.991	DDB1- and CUL4-associated factor 1
10	9606.ENSP00000231948	0.989	Protein cereblon
11	9606.ENSP00000250495	0.989	NEDD8
12	9606.ENSP00000352928	0.989	DET1- and DDB1-associated protein 1
13	9606.ENSP00000456340	0.986	DET1 homolog
14	9606.ENSP00000304102	0.980	COP9 signalosome complex subunit 6
15	9606.ENSP00000265038	0.979	DNA excision repair protein ERCC-8
16	9606.ENSP00000364589	0.976	Cullin-4A
17	9606.ENSP00000299259	0.973	COP9 signalosome complex subunit 2
18	9606.ENSP00000357052	0.971	DDB1- and CUL4-associated factor 8
19	9606.ENSP00000346340	0.968	COP9 signalosome complex subunit 8
20	9606.ENSP00000264389	0.963	COP9 signalosome complex subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.461	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0043170	0.987	macromolecule metabolic process
GO:0006807	0.972	nitrogen compound metabolic process
GO:0044238	0.956	primary metabolic process
GO:0050789	0.938	regulation of biological process
GO:0071840	0.913	cellular component organization or biogenesis
GO:0050794	0.906	regulation of cellular process
GO:0019538	0.880	protein metabolic process
GO:0044237	0.870	cellular metabolic process
GO:0050896	0.868	response to stimulus
GO:0032502	0.844	developmental process
GO:0019222	0.787	regulation of metabolic process
GO:0051171	0.765	regulation of nitrogen compound metabolic process
GO:0080090	0.763	regulation of primary metabolic process
GO:0060255	0.762	regulation of macromolecule metabolic process
GO:0032446	0.727	protein modification by small protein conjugation
GO:0048518	0.726	positive regulation of biological process
GO:0048856	0.698	anatomical structure development
GO:0032501	0.692	multicellular organismal process
GO:0051716	0.682	cellular response to stimulus
GO:0007275	0.650	multicellular organism development
GO:0048869	0.644	cellular developmental process
GO:0006950	0.608	response to stress
GO:0044260	0.592	cellular macromolecule metabolic process
GO:0033554	0.589	cellular response to stress
GO:0007399	0.555	nervous system development
GO:0016567	0.551	protein ubiquitination
GO:0016043	0.521	cellular component organization
GO:1901360	0.519	organic cyclic compound metabolic process
GO:0046483	0.509	heterocycle metabolic process
GO:0006725	0.496	cellular aromatic compound metabolic process
GO:0048522	0.481	positive regulation of cellular process
GO:0034641	0.448	cellular nitrogen compound metabolic process
GO:0090304	0.442	nucleic acid metabolic process
GO:0006508	0.440	proteolysis
GO:0006974	0.435	cellular response to DNA damage stimulus
GO:0030154	0.422	cell differentiation
GO:0009893	0.386	positive regulation of metabolic process
GO:0010604	0.378	positive regulation of macromolecule metabolic process
GO:0051173	0.376	positive regulation of nitrogen compound metabolic process
GO:0031323	0.370	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0032991	0.992	protein-containing complex
GO:1902494	0.948	catalytic complex
GO:0140535	0.938	intracellular protein-containing complex
GO:1990234	0.937	transferase complex
GO:0000151	0.869	ubiquitin ligase complex
GO:0031461	0.776	cullin-RING ubiquitin ligase complex
GO:0080008	0.741	Cul4-RING E3 ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]