StarFunc result for job id Q13621

User Input

>input (1099 residues)
MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRI
SFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGS
ISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQAGVVKFGWV
KGVLVRCMLNIWGVMLFIRLSWIVGEAGIGLGVLIILLSTMVTSITGLSTSAIATNGFVR
GGGAYYLISRSLGPEFGGSIGLIFAFANAVAVAMYVVGFAETVVDLLKESDSMMVDPTND
IRIIGSITVVILLGISVAGMEWEAKAQVILLVILLIAIANFFIGTVIPSNNEKKSRGFFN
YQASIFAENFGPRFTKGEGFFSVFAIFFPAATGILAGANISGDLEDPQDAIPRGTMLAIF
ITTVAYLGVAICVGACVVRDATGNMNDTIISGMNCNGSAACGLGYDFSRCRHEPCQYGLM
NNFQVMSMVSGFGPLITAGIFSATLSSALASLVSAPKVFQALCKDNIYKALQFFAKGYGK
NNEPLRGYILTFLIAMAFILIAELNTIAPIISNFFLASYALINFSCFHASYAKSPGWRPA
YGIYNMWVSLFGAVLCCAVMFVINWWAAVITYVIEFFLYVYVTCKKPDVNWGSSTQALSY
VSALDNALELTTVEDHVKNFRPQCIVLTGGPMTRPALLDITHAFTKNSGLCICCEVFVGP
RKLCVKEMNSGMAKKQAWLIKNKIKAFYAAVAADCFRDGVRSLLQASGLGRMKPNTLVIG
YKKNWRKAPLTEIENYVGIIHDAFDFEIGVVIVRISQGFDISQVLQVQEELERLEQERLA
LEATIKDNECEEESGGIRGLFKKAGKLNITKTTPKKDGSINTSQSMHVGEFNQKLVEAST
QFKKKQEKGTIDVWWLFDDGGLTLLIPYILTLRKKWKDCKLRIYVGGKINRIEEEKIVMA
SLLSKFRIKFADIHIIGDINIRPNKESWKVFEEMIEPYRLHESCKDLTTAEKLKRETPWK
ITDAELEAVKEKSYRQVRLNELLQEHSRAANLIVLSLPVARKGSISDLLYMAWLEILTKN
LPPVLLVRGNHKNVLTFYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P55013	0.846	0.781	0.000	1191	0.611	0.563	P55013.pdb.gz	S12A2_SQUAC Solute carrier family 12 member 2 OS=Squalus acanthias OX=7797 GN=SLC12A2 PE=1 SV=1
2	AFDB:Q13621	1.000	1.000	0.000	1099	1.000	1.000	Q13621.pdb.gz	S12A1_HUMAN Solute carrier family 12 member 1 OS=Homo sapiens OX=9606 GN=SLC12A1 PE=1 SV=2
3	AFDB:P55017	0.817	0.877	8.832E-102	1021	0.490	0.528	P55017.pdb.gz	S12A3_HUMAN Solute carrier family 12 member 3 OS=Homo sapiens OX=9606 GN=SLC12A3 PE=1 SV=3
4	AFDB:Q1LX46	0.822	0.891	7.840E-101	1012	0.490	0.532	Q1LX46.pdb.gz	Q1LX46_DANRE Solute carrier family 12 member 3 OS=Danio rerio OX=7955 GN=si:ch211-122c9.4 PE=1 SV=1
5	PDB:7s1xB	0.712	0.888	3.080E-88	871	0.569	0.718	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
6	AFDB:Q1L963	0.747	0.821	1.435E-83	998	0.417	0.459	Q1L963.pdb.gz	Q1L963_DANRE Solute carrier family 12 member 10, tandem duplicate 2 OS=Danio rerio OX=7955 GN=ncc2b PE=3 SV=1
7	AFDB:A0A0R4IYN4	0.585	0.936	2.076E-76	681	0.442	0.714	A0A0R4IYN4.pdb.gz
8	AFDB:Q2UVJ5	0.672	0.754	3.418E-51	975	0.247	0.279	Q2UVJ5.pdb.gz	CCC1_ARATH Cation-chloride cotransporter 1 OS=Arabidopsis thaliana OX=3702 GN=CCC1 PE=1 SV=1
9	AFDB:Q6Z0E2	0.659	0.729	7.622E-51	989	0.251	0.279	Q6Z0E2.pdb.gz	CCC1_ORYSJ Cation-chloride cotransporter 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CCC1 PE=2 SV=1
10	AFDB:Q5RK27	0.448	0.453	3.034E-50	1083	0.247	0.251	Q5RK27.pdb.gz	S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus OX=10116 GN=Slc12a7 PE=2 SV=2
11	AFDB:Q9W1G6	0.439	0.459	3.519E-49	1043	0.254	0.267	Q9W1G6.pdb.gz	Q9W1G6_DROME Kazachoc, isoform A OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2
12	PDB:6y5rA	0.406	0.491	1.212E-45	879	0.229	0.287	6y5rA.pdb.gz
13	PDB:6m1yA	0.410	0.471	4.683E-44	938	0.239	0.280	6m1yA.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
14	PDB:7airA	0.416	0.502	1.044E-43	885	0.236	0.293	7airA.pdb.gz	Phospho-regulation, nucleotide binding and ion access control in potassium-chloride cotransporters.
15	PDB:7d99A	0.412	0.492	1.365E-43	891	0.228	0.282	7d99A.pdb.gz	Structures and an activation mechanism of human potassium-chloride cotransporters.
16	PDB:6m23A	0.409	0.473	8.605E-42	936	0.227	0.267	6m23A.pdb.gz	Cryo-EM structures of the full-length human KCC2 and KCC3 cation-chloride cotransporters.
17	PDB:7d10A	0.389	0.944	9.836E-42	446	0.325	0.800	7d10A.pdb.gz
18	PDB:7d14A	0.395	0.498	3.912E-38	850	0.233	0.301	7d14A.pdb.gz
19	PDB:5j4nA	0.304	0.692	1.690E-10	437	0.073	0.183	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
20	PDB:7cmhB	0.308	0.677	3.154E-10	458	0.062	0.148	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KTI4	0.0	1275	1136	0.602	0.583	S12A2_DANRE Solute carrier family 12 member 2 OS=Danio rerio OX=7955 GN=slc12a2 PE=1 SV=3
2	A0A8I5ZP25	0.0	1363	1187	0.618	0.572	A0A8I5ZP25_RAT Solute carrier family 12 member 2 OS=Rattus norvegicus OX=10116 GN=Slc12a2 PE=1 SV=1
3	A9NJG3	0.0	1306	1147	0.604	0.579	A9NJG3_SALSA Na/K/2Cl co-transporter OS=Salmo salar OX=8030 GN=NKCC1a PE=2 SV=1
4	E9PTX9	0.0	1368	1203	0.621	0.567	E9PTX9_RAT Solute carrier family 12 member 2 OS=Rattus norvegicus OX=10116 GN=Slc12a2 PE=1 SV=1
5	M9PCA7	0.0	908	1191	0.467	0.431	M9PCA7_DROME Sodium chloride cotransporter 69, isoform C OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
6	M9PI37	0.0	738	1207	0.367	0.334	M9PI37_DROME Sodium chloride cotransporter 69, isoform E OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
7	P55011	0.0	1369	1212	0.618	0.560	S12A2_HUMAN Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1
8	P55012	0.0	1359	1205	0.618	0.563	S12A2_MOUSE Solute carrier family 12 member 2 OS=Mus musculus OX=10090 GN=Slc12a2 PE=1 SV=2
9	P55013	0.0	1358	1191	0.609	0.562	S12A2_SQUAC Solute carrier family 12 member 2 OS=Squalus acanthias OX=7797 GN=SLC12A2 PE=1 SV=1
10	P55014	0.0	2095	1095	0.939	0.942	S12A1_MOUSE Solute carrier family 12 member 1 OS=Mus musculus OX=10090 GN=Slc12a1 PE=1 SV=2
11	P55016	0.0	2069	1095	0.924	0.928	S12A1_RAT Solute carrier family 12 member 1 OS=Rattus norvegicus OX=10116 GN=Slc12a1 PE=1 SV=1
12	P55017	0.0	1070	1021	0.486	0.523	S12A3_HUMAN Solute carrier family 12 member 3 OS=Homo sapiens OX=9606 GN=SLC12A3 PE=1 SV=3
13	P55018	0.0	933	1002	0.469	0.514	S12A3_RAT Solute carrier family 12 member 3 OS=Rattus norvegicus OX=10116 GN=Slc12a3 PE=1 SV=2
14	P59158	0.0	1076	1002	0.500	0.548	S12A3_MOUSE Solute carrier family 12 member 3 OS=Mus musculus OX=10090 GN=Slc12a3 PE=1 SV=1
15	Q13621	0.0	2274	1099	1.000	1.000	S12A1_HUMAN Solute carrier family 12 member 1 OS=Homo sapiens OX=9606 GN=SLC12A1 PE=1 SV=2
16	Q1L963	0.0	884	998	0.421	0.464	Q1L963_DANRE Solute carrier family 12 member 10, tandem duplicate 2 OS=Danio rerio OX=7955 GN=ncc2b PE=3 SV=1
17	Q1LX46	0.0	1036	1012	0.491	0.534	Q1LX46_DANRE Solute carrier family 12 member 3 OS=Danio rerio OX=7955 GN=si:ch211-122c9.4 PE=1 SV=1
18	Q9QX10	0.0	1387	1203	0.620	0.566	Q9QX10_RAT Na-K-Cl cotransporter OS=Rattus norvegicus OX=10116 GN=Slc12a2 PE=2 SV=1
19	Q9VTW8	0.0	914	1171	0.463	0.435	Q9VTW8_DROME GH27027p OS=Drosophila melanogaster OX=7227 GN=Ncc69 PE=1 SV=1
20	Q9W1G5	4.81e-91	317	1059	0.194	0.201	Q9W1G5_DROME Kazachoc, isoform C OS=Drosophila melanogaster OX=7227 GN=kcc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00324 AA_permease	1.2e-147	504.0	Amino acid permease
2	PF13520 AA_permease_2	1.8e-16	71.7	Amino acid permease
3	PF08403 AA_permease_N	1.3e-30	116.0	Amino acid permease N-terminal
4	PF03522 SLC12	4.5e-148	505.4	Solute carrier family 12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000059043

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000007639	0.834	Uncharacterized protein
2	9598.ENSPTRP00000021530	0.816	Serine threonine kinase 39
3	9598.ENSPTRP00000037687	0.809	WNK lysine deficient protein kinase 3
4	9598.ENSPTRP00000015697	0.801	Uncharacterized protein
5	9598.ENSPTRP00000007718	0.773	Pan troglodytes WNK lysine deficient protein kinase 1 (WNK1), mRNA
6	9598.ENSPTRP00000025450	0.765	Oxidative-stress responsive 1
7	9598.ENSPTRP00000028611	0.756	Sodium/hydrogen exchanger
8	9598.ENSPTRP00000007879	0.742	CD163 molecule
9	9598.ENSPTRP00000001354	0.737	Uncharacterized protein
10	9598.ENSPTRP00000000392	0.733	Chloride channel, voltage-sensitive Kb
11	9598.ENSPTRP00000013456	0.708	Amiloride-sensitive sodium channel subunit gamma
12	9598.ENSPTRP00000008402	0.701	Aquaporin 2 (collecting duct)
13	9598.ENSPTRP00000007816	0.679	Amiloride-sensitive sodium channel subunit alpha
14	9598.ENSPTRP00000013389	0.671	Uncharacterized protein
15	9598.ENSPTRP00000051294	0.667	Renin is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney.
16	9598.ENSPTRP00000053410	0.667	Uncharacterized protein
17	9598.ENSPTRP00000057025	0.660	Uncharacterized protein
18	9598.ENSPTRP00000013457	0.627	Amiloride-sensitive sodium channel subunit beta
19	9598.ENSPTRP00000037707	0.626	Melanoma antigen family D, 2
20	9598.ENSPTRP00000034034	0.616	Solute carrier family 4 (anion exchanger), member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015379	1.000	potassium:chloride symporter activity
GO:0015378	1.000	sodium:chloride symporter activity
GO:0008511	0.871	sodium:potassium:chloride symporter activity
GO:0005515	0.863	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006811	0.987	monoatomic ion transport
GO:0009987	0.958	cellular process
GO:0055085	0.557	transmembrane transport
GO:0032501	0.556	multicellular organismal process
GO:0065007	0.478	biological regulation
GO:0050896	0.343	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.826	plasma membrane region
GO:0043226	0.754	organelle
GO:0043227	0.740	membrane-bounded organelle
GO:0005622	0.731	intracellular anatomical structure
GO:0045177	0.714	apical part of cell
GO:0005737	0.597	cytoplasm
GO:0031982	0.580	vesicle
GO:0016324	0.555	apical plasma membrane
GO:1903561	0.388	extracellular vesicle
GO:0070062	0.382	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]