StarFunc result for job id Q13625

User Input

>input (1128 residues)
MMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSERPVADNE
RMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRRKENGVN
SPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKLKRLK
EIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSKVEELTR
QLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNSEVAV
MDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSSTMPRMP
SRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADL
FPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQS
SEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSM
GTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTLLPPFRK
PQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHP
ENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQSDADLEA
LRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKSASVTAS
SESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEPEGVPDN
SPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEITGQVSL
PPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGI
TALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFA
MTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMKE
GDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1M5H6	0.316	0.316	0.000	1128	0.893	0.893	F1M5H6.pdb.gz	F1M5H6_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=2
2	AFDB:Q13625	1.000	1.000	0.000	1128	1.000	1.000	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
3	AFDB:F1R419	0.245	0.259	5.659E-102	1060	0.605	0.643	F1R419.pdb.gz	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
4	AFDB:F1QWN1	0.228	0.241	8.500E-101	1063	0.598	0.635	F1QWN1.pdb.gz	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
5	AFDB:Q96KQ4	0.269	0.276	8.493E-84	1090	0.485	0.502	Q96KQ4.pdb.gz	ASPP1_HUMAN Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=3
6	AFDB:D4A6A8	0.234	0.251	2.591E-77	1042	0.445	0.482	D4A6A8.pdb.gz	D4A6A8_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=1
7	PDB:8cs9A	0.096	0.133	8.928E-8	796	0.037	0.053	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
8	PDB:2dvwA	0.101	0.476	1.789E-6	229	0.036	0.179	2dvwA.pdb.gz
9	PDB:7df7B	0.096	0.830	4.767E-6	119	0.027	0.261	7df7B.pdb.gz
10	PDB:6jd6B	0.089	0.365	5.050E-6	192	0.028	0.167	6jd6B.pdb.gz
11	PDB:6mwqA	0.103	0.231	7.561E-6	493	0.034	0.077	6mwqA.pdb.gz
12	PDB:4oauC	0.098	0.158	8.988E-6	692	0.030	0.049	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:1wg0A	0.096	0.418	1.199E-5	243	0.032	0.148	1wg0A.pdb.gz
14	PDB:6v9hC	0.099	0.396	1.270E-5	270	0.024	0.100	6v9hC.pdb.gz
15	PDB:3ehqA	0.099	0.574	1.902E-5	182	0.024	0.148	3ehqA.pdb.gz
16	PDB:3lvqE	0.104	0.264	7.586E-5	420	0.034	0.090	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
17	AFDB:Q6W2J9	0.104	0.068	1.172E-4	1755	0.132	0.085	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
18	AFDB:Q5H9F3	0.100	0.067	1.975E-3	1711	0.132	0.087	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
19	AFDB:A0A0G2K490	0.078	0.067	5.575E-3	1360	0.112	0.093	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
20	AFDB:A0A024R9Y2	0.058	0.062	1.051E-2	1105	0.135	0.138	A0A024R9Y2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KB61	0.0	891	1088	0.493	0.511	A0A0G2KB61_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=2
2	A0A3B3ISJ2	0.0	880	1075	0.484	0.508	A0A3B3ISJ2_HUMAN Protein phosphatase 1 regulatory subunit 13B (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=1
3	A0A8I6A5P5	0.0	1711	1040	0.816	0.885	A0A8I6A5P5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=1
4	A0A8I6A8S6	0.0	900	1123	0.500	0.502	A0A8I6A8S6_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=4 SV=1
5	A0A8I6AMB5	0.0	1869	1146	0.871	0.858	A0A8I6AMB5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=1
6	A0A8I6ANU5	0.0	1897	1119	0.883	0.890	A0A8I6ANU5_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=4 SV=1
7	F1M5H6	0.0	1904	1128	0.886	0.886	F1M5H6_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=2
8	Q05BL1	0.0	2120	1048	0.921	0.991	Q05BL1_HUMAN TP53BP2 protein OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=1
9	Q13625	0.0	2316	1128	1.000	1.000	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
10	Q8CG79	0.0	1937	1128	0.910	0.910	ASPP2_MOUSE Apoptosis-stimulating of p53 protein 2 OS=Mus musculus OX=10090 GN=Tp53bp2 PE=1 SV=3
11	Q96KQ4	0.0	913	1090	0.496	0.514	ASPP1_HUMAN Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=3
12	Q1LXN7	3.18e-155	492	1060	0.192	0.205	Q1LXN7_DANRE Tumor protein p53 binding protein, 2 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=1
13	F1QWN1	3.77e-155	492	1063	0.192	0.204	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
14	F1R419	4.76e-146	468	1060	0.193	0.206	F1R419_DANRE Apoptosis-stimulating of p53 protein 2 isoform X1 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
15	Q6NSN9	1.23e-144	464	1060	0.184	0.196	Q6NSN9_DANRE Apoptosis-stimulating of p53 protein 2 OS=Danio rerio OX=7955 GN=tp53bp2 PE=1 SV=1
16	D4A6A8	1.31e-86	305	1042	0.142	0.154	D4A6A8_RAT Protein phosphatase 1, regulatory subunit 13B OS=Rattus norvegicus OX=10116 GN=Ppp1r13b PE=1 SV=1
17	Q86PC3	2.15e-84	298	1020	0.114	0.126	Q86PC3_DROME RE13301p OS=Drosophila melanogaster OX=7227 GN=ASPP PE=2 SV=1
18	Q9W2J2	2.37e-84	298	1020	0.114	0.126	Q9W2J2_DROME Ankyrin-repeat, SH3-domain, and Proline-rich-region containing protein, isoform A OS=Drosophila melanogaster OX=7227 GN=ASPP PE=4 SV=3
19	A0A0B4KF17	3.21e-84	298	1046	0.114	0.123	A0A0B4KF17_DROME Ankyrin-repeat, SH3-domain, and Proline-rich-region containing protein, isoform C OS=Drosophila melanogaster OX=7227 GN=ASPP PE=4 SV=1
20	Q86BG1	6.30e-84	298	1069	0.114	0.121	Q86BG1_DROME Ankyrin-repeat, SH3-domain, and Proline-rich-region containing protein, isoform B OS=Drosophila melanogaster OX=7227 GN=ASPP PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1e-10	52.8	Ankyrin repeat
2	PF12796 Ank_2	1.6e-13	62.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.1e-09	48.5	Ankyrin repeat
4	PF13637 Ank_4	1.1e-14	65.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	7.5e-06	37.4	Ankyrin repeats (many copies)
6	PF00018 SH3_1	1.6e-08	45.4	SH3 domain
7	PF07653 SH3_2	0.0033	28.5	Variant SH3 domain
8	PF14604 SH3_9	1.5e-07	42.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341957

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
2	9606.ENSP00000326031	0.990	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
3	9606.ENSP00000478927	0.990	Transcriptional coactivator YAP1
4	9606.ENSP00000341779	0.988	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
5	9606.ENSP00000357722	0.977	Protein S100-A8
6	9606.ENSP00000384491	0.968	Ras association domain family member 8
7	9606.ENSP00000367545	0.957	Tumor protein p73
8	9606.ENSP00000378769	0.952	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
9	9606.ENSP00000238721	0.944	Quinone oxidoreductase PIG3
10	9606.ENSP00000347979	0.923	Tumor necrosis factor receptor superfamily member 6
11	9606.ENSP00000404503	0.923	Bcl-2-binding component 3
12	9606.ENSP00000363921	0.917	Partitioning defective 3 homolog
13	9606.ENSP00000464050	0.909	ATP-dependent RNA helicase DDX42
14	9606.ENSP00000293288	0.904	Apoptosis regulator BAX
15	9606.ENSP00000299163	0.904	Hypoxia-inducible factor 1-alpha inhibitor
16	9606.ENSP00000358072	0.894	Autophagy protein 5
17	9606.ENSP00000419465	0.870	WW domain-containing transcription regulator protein 1
18	9606.ENSP00000264731	0.844	Tumor protein 63
19	9606.ENSP00000380713	0.829	Ras association domain-containing protein 7
20	9606.ENSP00000390158	0.796	Probable E3 ubiquitin-protein ligase HERC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140297	0.839	DNA-binding transcription factor binding
GO:0042802	0.651	identical protein binding
GO:0061629	0.534	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0002039	0.521	p53 binding
GO:0051059	0.506	NF-kappaB binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0010942	0.976	positive regulation of cell death
GO:0009987	0.893	cellular process
GO:1901214	0.855	regulation of neuron death
GO:0050896	0.827	response to stimulus
GO:1901216	0.789	positive regulation of neuron death
GO:0051716	0.742	cellular response to stimulus
GO:0048519	0.737	negative regulation of biological process
GO:0048523	0.701	negative regulation of cellular process
GO:0007154	0.655	cell communication
GO:0007165	0.631	signal transduction
GO:0042981	0.546	regulation of apoptotic process
GO:0012501	0.523	programmed cell death
GO:0035556	0.488	intracellular signal transduction
GO:0006915	0.409	apoptotic process
GO:0008152	0.310	metabolic process
GO:0019222	0.305	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.959	intracellular organelle lumen
GO:0005654	0.919	nucleoplasm
GO:0005737	0.881	cytoplasm
GO:0005829	0.467	cytosol
GO:0048471	0.385	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]