StarFunc result for job id Q13627

User Input

>input (763 residues)
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFTAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13627	1.000	1.000	0.000	763	1.000	1.000	Q13627.pdb.gz	DYR1A_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2
2	AFDB:Q76NV1	0.457	0.417	3.026E-48	836	0.329	0.300	Q76NV1.pdb.gz	DYRK1_DICDI Probable serine/threonine-protein kinase dyrk1 OS=Dictyostelium discoideum OX=44689 GN=dyrk1 PE=3 SV=1
3	AFDB:Q8RWH3	0.420	0.337	3.037E-34	956	0.263	0.210	Q8RWH3.pdb.gz	YAK1_ARATH Dual specificity protein kinase YAK1 homolog OS=Arabidopsis thaliana OX=3702 GN=YAK1 PE=1 SV=1
4	PDB:5y86A	0.401	0.758	5.240E-34	395	0.190	0.367	5y86A.pdb.gz	Crystal Structure of Human Dual-Specificity Tyrosine-Regulated Kinase 3 Reveals New Structural Features and Insights into its Auto-phosphorylation
5	AFDB:Q9ERH7	0.415	0.270	9.939E-33	1192	0.245	0.157	Q9ERH7.pdb.gz	HIPK3_MOUSE Homeodomain-interacting protein kinase 3 OS=Mus musculus OX=10090 GN=Hipk3 PE=1 SV=3
6	AFDB:Q9H2X6	0.399	0.259	1.192E-31	1198	0.274	0.174	Q9H2X6.pdb.gz	HIPK2_HUMAN Homeodomain-interacting protein kinase 2 OS=Homo sapiens OX=9606 GN=HIPK2 PE=1 SV=2
7	PDB:6khdB	0.379	0.851	6.635E-26	332	0.144	0.331	6khdB.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
8	PDB:6kheA	0.394	0.865	7.776E-26	342	0.143	0.319	6kheA.pdb.gz	Structural Basis for the Selective Inhibition of Cdc2-Like Kinases by CX-4945.
9	PDB:6fadC	0.379	0.773	8.642E-26	359	0.135	0.287	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
10	PDB:6qx9K	0.377	0.875	1.546E-25	322	0.136	0.323	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
11	AFDB:Q586V3	0.360	0.268	4.938E-22	1037	0.178	0.131	Q586V3.pdb.gz	Q586V3_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.450 PE=4 SV=1
12	PDB:4krcA	0.340	0.834	1.733E-20	297	0.123	0.316	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
13	PDB:4yc3A	0.338	0.829	1.926E-20	295	0.123	0.319	4yc3A.pdb.gz
14	PDB:1unlA	0.334	0.835	2.509E-20	292	0.126	0.329	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:4eomC	0.307	0.815	9.405E-20	276	0.122	0.337	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
16	PDB:5xvuA	0.335	0.750	2.017E-18	321	0.111	0.265	5xvuA.pdb.gz	The protein kinase CK2 catalytic domain from Plasmodium falciparum: crystal structure, tyrosine kinase activity and inhibition.
17	AFDB:O08815	0.301	0.193	8.202E-16	1206	0.163	0.103	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
18	AFDB:Q9VU14	0.309	0.284	8.648E-16	835	0.165	0.151	Q9VU14.pdb.gz	Q9VU14_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Atg1 PE=2 SV=1
19	AFDB:A1ZBL7	0.267	0.207	1.252E-15	993	0.208	0.160	A1ZBL7.pdb.gz	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
20	AFDB:Q8ILF0	0.344	0.291	3.603E-15	914	0.173	0.144	Q8ILF0.pdb.gz	Q8ILF0_PLAF7 Mitogen-activated protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1431500 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4II39	0.0	773	681	0.502	0.562	A0A0R4II39_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=si:ch211-225p5.1 PE=3 SV=1
2	A1L1U2	0.0	1065	737	0.789	0.817	A1L1U2_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk1a PE=2 SV=1
3	D1L3Y5	0.0	780	751	0.502	0.510	D1L3Y5_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=si:ch211-225p5.1 PE=2 SV=1
4	P49657	0.0	735	908	0.453	0.381	MNB_DROME Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster OX=7227 GN=mnb PE=1 SV=2
5	Q13627	0.0	1606	763	1.000	1.000	DYR1A_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2
6	Q61214	0.0	1594	763	0.992	0.992	DYR1A_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Mus musculus OX=10090 GN=Dyrk1a PE=1 SV=1
7	Q63470	0.0	1601	763	0.996	0.996	DYR1A_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Rattus norvegicus OX=10116 GN=Dyrk1a PE=1 SV=2
8	Q9Y463	0.0	759	629	0.494	0.599	DYR1B_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens OX=9606 GN=DYRK1B PE=1 SV=1
9	Q9Z188	0.0	761	629	0.495	0.601	DYR1B_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus OX=10090 GN=Dyrk1b PE=1 SV=3
10	Q8WQL7	6.12e-176	529	882	0.338	0.293	MBK1_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis elegans OX=6239 GN=mbk-1 PE=1 SV=1
11	Q76NV1	1.27e-160	488	836	0.300	0.274	DYRK1_DICDI Probable serine/threonine-protein kinase dyrk1 OS=Dictyostelium discoideum OX=44689 GN=dyrk1 PE=3 SV=1
12	Q9XTF3	8.38e-92	307	817	0.204	0.191	MBK2_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans OX=6239 GN=mbk-2 PE=1 SV=1
13	A9JRD5	2.51e-90	296	581	0.220	0.289	A9JRD5_DANRE dual-specificity kinase OS=Danio rerio OX=7955 GN=dyrk2 PE=2 SV=1
14	Q9NR20	3.06e-89	292	520	0.221	0.325	DYRK4_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens OX=9606 GN=DYRK4 PE=1 SV=2
15	A0A0A0MTH5	2.14e-88	293	634	0.220	0.265	A0A0A0MTH5_HUMAN dual-specificity kinase OS=Homo sapiens OX=9606 GN=DYRK4 PE=1 SV=1
16	Q5U4C9	1.57e-87	290	599	0.207	0.264	DYRK2_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus OX=10090 GN=Dyrk2 PE=2 SV=1
17	Q92630	5.35e-87	288	601	0.207	0.263	DYRK2_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3
18	Q922Y0	2.72e-86	286	586	0.194	0.253	DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus OX=10090 GN=Dyrk3 PE=1 SV=1
19	Q9V3D5	4.25e-86	289	722	0.244	0.258	DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster OX=7227 GN=Dyrk2 PE=1 SV=1
20	O43781	5.51e-86	285	588	0.212	0.276	DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens OX=9606 GN=DYRK3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	2.6e-46	169.7	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	1.5e-18	78.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381932

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483236	0.999	DDB1- and CUL4-associated factor 7
2	9606.ENSP00000451812	0.987	Protein lin-52 homolog
3	9606.ENSP00000341947	0.954	Protein lin-54 homolog
4	9606.ENSP00000361930	0.948	14-3-3 protein beta/alpha
5	9606.ENSP00000329102	0.943	Protein lin-9 homolog
6	9606.ENSP00000301159	0.941	Protein lin-37 homolog
7	9606.ENSP00000299563	0.934	E3 ubiquitin-protein ligase RNF169
8	9606.ENSP00000362592	0.922	Histone-binding protein RBBP4
9	9606.ENSP00000370527	0.895	Calcipressin-1
10	9606.ENSP00000239906	0.883	Protein FAM53C
11	9606.ENSP00000223145	0.842	Glucocorticoid-induced transcript 1 protein
12	9606.ENSP00000376071	0.814	Protein FAM117B
13	9606.ENSP00000359719	0.785	cAMP-dependent protein kinase catalytic subunit beta
14	9606.ENSP00000246166	0.784	Protein farnesyltransferase subunit beta
15	9606.ENSP00000386520	0.784	Helicase ARIP4
16	9606.ENSP00000398481	0.772	Calcium-dependent secretion activator 2
17	9606.ENSP00000340820	0.763	Microtubule-associated protein tau
18	9606.ENSP00000369981	0.762	Endophilin-A1
19	9606.ENSP00000309591	0.760	cAMP-dependent protein kinase catalytic subunit alpha
20	9606.ENSP00000409667	0.749	Synaptojanin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0042802	0.722	identical protein binding
GO:0008092	0.674	cytoskeletal protein binding
GO:0004715	0.506	non-membrane spanning protein tyrosine kinase activity
GO:0035173	0.505	histone kinase activity
GO:0008353	0.505	RNA polymerase II CTD heptapeptide repeat kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.995	biological regulation
GO:0050794	0.993	regulation of cellular process
GO:0044238	0.983	primary metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0018212	0.973	peptidyl-tyrosine modification
GO:0046777	0.964	protein autophosphorylation
GO:0080090	0.947	regulation of primary metabolic process
GO:0051171	0.943	regulation of nitrogen compound metabolic process
GO:0018209	0.940	peptidyl-serine modification
GO:0031323	0.913	regulation of cellular metabolic process
GO:0048518	0.911	positive regulation of biological process
GO:0018105	0.908	peptidyl-serine phosphorylation
GO:0018108	0.808	peptidyl-tyrosine phosphorylation
GO:0019219	0.799	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.764	regulation of gene expression
GO:0051252	0.718	regulation of RNA metabolic process
GO:0010604	0.700	positive regulation of macromolecule metabolic process
GO:0051173	0.693	positive regulation of nitrogen compound metabolic process
GO:0048522	0.689	positive regulation of cellular process
GO:0043484	0.523	regulation of RNA splicing
GO:0031325	0.499	positive regulation of cellular metabolic process
GO:0051254	0.357	positive regulation of RNA metabolic process
GO:0048519	0.356	negative regulation of biological process
GO:0050896	0.318	response to stimulus
GO:0048523	0.305	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.957	cytoplasm
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0016604	0.885	nuclear body
GO:0005856	0.572	cytoskeleton
GO:0016607	0.472	nuclear speck
GO:0015630	0.376	microtubule cytoskeleton
GO:0005829	0.347	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.506	non-specific protein-tyrosine kinase.
RHEA:10216	0.505	[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase]
EC:2.7.11.23	0.505	[RNA-polymerase]-subunit kinase.

[back to server]