StarFunc result for job id Q13630

User Input

>input (321 residues)
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEK
VQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPD
KTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNF
NIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPI
ILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTP
FKQAVKETCAWFTDNYEQARK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P23591	0.998	0.998	1.520E-66	321	0.938	0.938	P23591.pdb.gz	FCL_MOUSE GDP-L-fucose synthase OS=Mus musculus OX=10090 GN=Gfus PE=1 SV=3
2	PDB:4bkpC	0.972	0.957	7.302E-62	326	0.981	0.966	4bkpC.pdb.gz	Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp
3	AFDB:G5EER4	0.974	0.993	4.259E-53	315	0.632	0.644	G5EER4.pdb.gz	FCL_CAEEL GDP-L-fucose synthase OS=Caenorhabditis elegans OX=6239 GN=ger-1 PE=1 SV=1
4	AFDB:Q55C77	0.979	0.983	4.350E-52	320	0.617	0.619	Q55C77.pdb.gz	FCL_DICDI GDP-L-fucose synthase OS=Dictyostelium discoideum OX=44689 GN=ger PE=1 SV=1
5	AFDB:Q9W1X8	0.964	0.964	9.111E-50	321	0.589	0.589	Q9W1X8.pdb.gz	FCL_DROME Probable GDP-L-fucose synthase OS=Drosophila melanogaster OX=7227 GN=Gmer PE=1 SV=1
6	AFDB:Q382D8	0.977	0.876	2.055E-49	358	0.551	0.494	Q382D8.pdb.gz	Q382D8_TRYB2 GDP-L-fucose synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5560 PE=3 SV=1
7	PDB:4e5yC	0.860	0.949	6.676E-47	290	0.897	0.993	4e5yC.pdb.gz	Structure of human FX protein, the key enzyme in the biosynthesis of GDP-L-fucose
8	AFDB:O49213	0.915	0.909	2.201E-32	323	0.346	0.344	O49213.pdb.gz	FCL1_ARATH GDP-L-fucose synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GER1 PE=1 SV=3
9	AFDB:G4WJD3	0.884	0.920	7.615E-31	308	0.255	0.266	G4WJD3.pdb.gz	COLC_YERPU GDP-L-colitose synthase OS=Yersinia pseudotuberculosis OX=633 GN=colC PE=1 SV=1
10	AFDB:P32055	0.914	0.914	7.778E-30	321	0.274	0.274	P32055.pdb.gz	FCL_ECOLI GDP-L-fucose synthase OS=Escherichia coli (strain K12) OX=83333 GN=fcl PE=1 SV=2
11	PDB:1bsvA	0.860	0.870	1.613E-29	317	0.274	0.278	1bsvA.pdb.gz	GDP-fucose synthetase from Escherichia coli: structure of a unique member of the short-chain dehydrogenase/reductase family that catalyzes two distinct reactions at the same active site.
12	AFDB:P26391	0.758	0.681	6.639E-21	361	0.218	0.194	P26391.pdb.gz	RMLB_SALTY dTDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbB PE=1 SV=1
13	AFDB:P27830	0.776	0.708	8.877E-21	355	0.227	0.206	P27830.pdb.gz	RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rffG PE=1 SV=3
14	PDB:6lttA	0.766	0.789	5.551E-20	311	0.234	0.241	6lttA.pdb.gz
15	PDB:1keuA	0.769	0.689	1.490E-19	361	0.218	0.194	1keuA.pdb.gz	Toward a structural understanding of the dehydratase mechanism.
16	PDB:2pk3A	0.780	0.808	3.361E-19	309	0.153	0.159	2pk3A.pdb.gz	The structural basis for catalytic function of GMD and RMD, two closely related enzymes from the GDP-D-rhamnose biosynthesis pathway.
17	PDB:2c59A	0.808	0.718	7.153E-19	364	0.190	0.168	2c59A.pdb.gz	Structure and Function of Gdp-Mannose-3',5'-Epimerase: An Enzyme which Performs Three Chemical Reactions at the Same Active Site.
18	PDB:1bxkB	0.739	0.693	3.639E-18	344	0.212	0.198	1bxkB.pdb.gz	Molecular Structure of Dtdp-Glucose 4,6-Dehydratase from E. Coli
19	PDB:1a9yA	0.770	0.735	3.507E-17	338	0.171	0.163	1a9yA.pdb.gz	Dramatic differences in the binding of UDP-galactose and UDP-glucose to UDP-galactose 4-epimerase from Escherichia coli.
20	PDB:1i3kA	0.753	0.701	1.057E-16	347	0.231	0.213	1i3kA.pdb.gz	Molecular basis for severe epimerase deficiency galactosemia. X-ray structure of the human V94m-substituted UDP-galactose 4-epimerase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23591	0.0	639	321	0.938	0.938	FCL_MOUSE GDP-L-fucose synthase OS=Mus musculus OX=10090 GN=Gfus PE=1 SV=3
2	Q13630	0.0	675	321	1.000	1.000	FCL_HUMAN GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=GFUS PE=1 SV=1
3	G5EER4	2.26e-155	439	315	0.632	0.644	FCL_CAEEL GDP-L-fucose synthase OS=Caenorhabditis elegans OX=6239 GN=ger-1 PE=1 SV=1
4	Q55C77	8.97e-154	435	320	0.617	0.619	FCL_DICDI GDP-L-fucose synthase OS=Dictyostelium discoideum OX=44689 GN=ger PE=1 SV=1
5	Q9W1X8	3.17e-141	403	321	0.589	0.589	FCL_DROME Probable GDP-L-fucose synthase OS=Drosophila melanogaster OX=7227 GN=Gmer PE=1 SV=1
6	Q382D8	6.17e-136	391	358	0.548	0.492	Q382D8_TRYB2 GDP-L-fucose synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5560 PE=3 SV=1
7	O49213	6.28e-54	181	323	0.340	0.337	FCL1_ARATH GDP-L-fucose synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GER1 PE=1 SV=3
8	P32055	1.13e-43	154	321	0.283	0.283	FCL_ECOLI GDP-L-fucose synthase OS=Escherichia coli (strain K12) OX=83333 GN=fcl PE=1 SV=2
9	G4WJD3	1.63e-40	145	308	0.283	0.295	COLC_YERPU GDP-L-colitose synthase OS=Yersinia pseudotuberculosis OX=633 GN=colC PE=1 SV=1
10	Q9ZV36	1.15e-14	75.9	343	0.262	0.245	UXS6_ARATH UDP-glucuronic acid decarboxylase 6 OS=Arabidopsis thaliana OX=3702 GN=UXS6 PE=2 SV=1
11	F4KHU8	1.15e-13	73.2	357	0.259	0.232	F4KHU8_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS3 PE=1 SV=1
12	Q5PQX0	2.20e-13	72.4	420	0.255	0.195	UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus OX=10116 GN=Uxs1 PE=1 SV=1
13	Q91XL3	2.37e-13	72.4	420	0.252	0.193	UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus OX=10090 GN=Uxs1 PE=1 SV=1
14	Q8NBZ7	2.55e-13	72.4	420	0.252	0.193	UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens OX=9606 GN=UXS1 PE=1 SV=1
15	Q9SN95	8.30e-13	70.5	341	0.274	0.258	UXS5_ARATH UDP-glucuronic acid decarboxylase 5 OS=Arabidopsis thaliana OX=3702 GN=UXS5 PE=2 SV=1
16	Q6GMI9	9.94e-13	70.5	418	0.246	0.189	UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio OX=7955 GN=uxs1 PE=1 SV=2
17	Q8VZC0	3.50e-11	65.9	435	0.240	0.177	UXS1_ARATH UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
18	F4JAG3	8.16e-09	58.9	458	0.215	0.151	F4JAG3_ARATH UDP-glucuronate decarboxylase OS=Arabidopsis thaliana OX=3702 GN=UXS1 PE=1 SV=1
19	Q9LZI2	1.53e-08	57.8	445	0.231	0.166	UXS2_ARATH UDP-glucuronic acid decarboxylase 2 OS=Arabidopsis thaliana OX=3702 GN=UXS2 PE=1 SV=1
20	O95455	2.12e-08	57.0	350	0.227	0.209	TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens OX=9606 GN=TGDS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01073 3Beta_HSD	0.8	20.2	3-beta hydroxysteroid dehydrogenase/isomerase family
2	PF01370 Epimerase	5.7e-55	198.0	NAD dependent epimerase/dehydratase family
3	PF16363 GDP_Man_Dehyd	4.1e-11	54.5	GDP-mannose 4,6 dehydratase
4	PF07406 NICE-3	27	16.2	NICE-3 protein
5	PF02719 Polysacc_synt_2	0.65	20.7	Polysaccharide biosynthesis protein
6	PF04321 RmlD_sub_bind	0.00018	32.2	RmlD substrate binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398803

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370194	0.998	GDP-mannose 4,6 dehydratase
2	9606.ENSP00000359935	0.963	Fucose-1-phosphate guanylyltransferase
3	9606.ENSP00000288078	0.798	L-fucose kinase
4	9606.ENSP00000325425	0.687	Methionine adenosyltransferase 2 subunit beta
5	9606.ENSP00000300134	0.681	Signal transducer and activator of transcription 6
6	9606.ENSP00000483375	0.669	UDP-glucose 4-epimerase
7	9606.ENSP00000313318	0.668	GDP-fucose transporter 1
8	9606.ENSP00000464814	0.664	Bifunctional coenzyme A synthase
9	9606.ENSP00000206542	0.657	Probable tRNA N6-adenosine threonylcarbamoyltransferase
10	9606.ENSP00000410059	0.654	Elongation factor 1-delta
11	9606.ENSP00000353910	0.634	Alpha-(1,6)-fucosyltransferase
12	9606.ENSP00000342075	0.601	SUMO-interacting motif-containing protein 1
13	9606.ENSP00000451818	0.596	Signal recognition particle 54 kDa protein
14	9606.ENSP00000419851	0.585	GMP synthase [glutamine-hydrolyzing]
15	9606.ENSP00000371110	0.553	2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial
16	9606.ENSP00000355629	0.547	Conserved oligomeric Golgi complex subunit 2
17	9606.ENSP00000220966	0.510	Pyrroline-5-carboxylate reductase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0016853	0.998	isomerase activity
GO:0042802	0.996	identical protein binding
GO:0016857	0.994	racemase and epimerase activity, acting on carbohydrates and derivatives
GO:0009055	0.991	electron transfer activity
GO:0050577	0.936	GDP-L-fucose synthase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:1901576	0.993	organic substance biosynthetic process
GO:1901135	0.991	carbohydrate derivative metabolic process
GO:0044281	0.990	small molecule metabolic process
GO:1901360	0.977	organic cyclic compound metabolic process
GO:0006725	0.966	cellular aromatic compound metabolic process
GO:0034641	0.965	cellular nitrogen compound metabolic process
GO:0006139	0.963	nucleobase-containing compound metabolic process
GO:0055086	0.941	nucleobase-containing small molecule metabolic process
GO:1901137	0.939	carbohydrate derivative biosynthetic process
GO:1901362	0.913	organic cyclic compound biosynthetic process
GO:0044249	0.902	cellular biosynthetic process
GO:0009225	0.875	nucleotide-sugar metabolic process
GO:0065007	0.820	biological regulation
GO:0050789	0.814	regulation of biological process
GO:0050794	0.797	regulation of cellular process
GO:0006793	0.679	phosphorus metabolic process
GO:0034654	0.634	nucleobase-containing compound biosynthetic process
GO:0030155	0.544	regulation of cell adhesion
GO:0009226	0.532	nucleotide-sugar biosynthetic process
GO:0010810	0.342	regulation of cell-substrate adhesion
GO:0050896	0.340	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0005576	0.979	extracellular region
GO:1903561	0.965	extracellular vesicle
GO:0070062	0.964	extracellular exosome
GO:0043231	0.951	intracellular membrane-bounded organelle
GO:0016020	0.780	membrane
GO:0032991	0.431	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
EC:5.-.-.-	0.998	Isomerases.
EC:5.1.3.-	0.994	Acting on carbohydrates and derivatives.
RHEA:18885	0.936	GDP-beta-L-fucose + NADP(+) = GDP-4-dehydro-alpha-D-rhamnose + H(+) + NADPH
EC:1.1.1.271	0.936	GDP-L-fucose synthase.

[back to server]