StarFunc result for job id Q13635

User Input

>input (1447 residues)
MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAF
ALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAAN
LETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLD
SALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAK
LQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPA
DPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHAL
QTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVL
SFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALS
VAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGEC
LKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDL
YRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQS
TVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSL
HCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDI
VPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQL
PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDIS
QLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETR
LRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQ
YIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSA
VPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLML
AGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEP
PPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATE
NPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRR
DAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVA
VHPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEER
PRGSSSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6dmyA	0.677	0.984	0.000	992	0.683	0.996	6dmyA.pdb.gz	Structural basis for the recognition of Sonic Hedgehog by human Patched1.
2	AFDB:Q13635	1.000	1.000	0.000	1447	1.000	1.000	Q13635.pdb.gz	PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens OX=9606 GN=PTCH1 PE=1 SV=2
3	AFDB:Q98864	0.741	0.877	0.000	1220	0.534	0.633	Q98864.pdb.gz	PTC1_DANRE Protein patched homolog 1 OS=Danio rerio OX=7955 GN=ptch1 PE=2 SV=1
4	AFDB:Q9Y6C5	0.716	0.858	0.000	1203	0.453	0.545	Q9Y6C5.pdb.gz	PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens OX=9606 GN=PTCH2 PE=1 SV=2
5	AFDB:P18502	0.712	0.799	2.411E-91	1286	0.334	0.376	P18502.pdb.gz	PTC_DROME Protein patched OS=Drosophila melanogaster OX=7227 GN=ptc PE=2 SV=2
6	PDB:6v3fA	0.498	0.578	4.724E-34	1234	0.162	0.190	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition
7	AFDB:Q96F81	0.404	0.387	8.309E-21	1524	0.138	0.131	Q96F81.pdb.gz	DISP1_HUMAN Protein dispatched homolog 1 OS=Homo sapiens OX=9606 GN=DISP1 PE=1 SV=3
8	AFDB:Q3TDN0	0.373	0.356	1.497E-20	1521	0.133	0.126	Q3TDN0.pdb.gz	DISP1_MOUSE Protein dispatched homolog 1 OS=Mus musculus OX=10090 GN=Disp1 PE=1 SV=2
9	AFDB:Q6R5J1	0.415	0.408	1.466E-18	1476	0.126	0.123	Q6R5J1.pdb.gz	DISP2_DANRE Protein dispatched homolog 2 OS=Danio rerio OX=7955 GN=disp2 PE=2 SV=1
10	PDB:6tbuA	0.361	0.580	2.675E-16	842	0.086	0.148	6tbuA.pdb.gz	Cryo-EM structure of the Hedgehog release protein Dispatched.
11	PDB:7n6bA	0.373	0.672	2.647E-13	757	0.068	0.129	7n6bA.pdb.gz	Structures of the mycobacterial membrane protein MmpL3 reveal its mechanism of lipid transport.
12	PDB:7e2iD	0.375	0.559	4.770E-13	907	0.091	0.144	7e2iD.pdb.gz	Structural insights into proteolytic activation of the human Dispatched1 transporter for Hedgehog morphogen release.
13	PDB:2v50D	0.287	0.404	2.285E-11	998	0.085	0.123	2v50D.pdb.gz
14	PDB:3nogA	0.269	0.369	4.870E-11	1012	0.086	0.123	3nogA.pdb.gz
15	PDB:3w9iF	0.283	0.385	1.129E-10	1033	0.102	0.143	3w9iF.pdb.gz
16	PDB:7wnxA	0.357	0.666	2.511E-10	734	0.069	0.136	7wnxA.pdb.gz	Cryo-EM structure of Mycobacterium smegmatis MmpL3 complexed with ST004 in lipid nanodiscs
17	PDB:6bajA	0.271	0.379	6.890E-10	995	0.104	0.151	6bajA.pdb.gz
18	AFDB:Q9VLB3	0.068	0.075	2.351E-1	1197	0.090	0.109	Q9VLB3.pdb.gz	Q9VLB3_DROME Organic anion transporting polypeptide 30B, isoform A OS=Drosophila melanogaster OX=7227 GN=Oatp30B PE=3 SV=2
19	AFDB:Q6PR54	0.047	0.038	1.162	2419	0.105	0.063	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
20	AFDB:Q5BBH9	0.062	0.080	1.264	1010	0.076	0.109	Q5BBH9.pdb.gz	Q5BBH9_EMENI KAR9-domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02101 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVB8	0.0	2756	1382	0.921	0.964	A0A0G2JVB8_RAT Patched 1 OS=Rattus norvegicus OX=10116 GN=Ptch1 PE=3 SV=1
2	F1R8E2	0.0	2072	1475	0.761	0.746	F1R8E2_DANRE Protein patched homolog 1 OS=Danio rerio OX=7955 GN=lep PE=3 SV=2
3	O35595	0.0	1259	1182	0.440	0.539	PTC2_MOUSE Protein patched homolog 2 OS=Mus musculus OX=10090 GN=Ptch2 PE=2 SV=2
4	P18502	0.0	868	1286	0.335	0.377	PTC_DROME Protein patched OS=Drosophila melanogaster OX=7227 GN=ptc PE=2 SV=2
5	Q13635	0.0	3006	1447	1.000	1.000	PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens OX=9606 GN=PTCH1 PE=1 SV=2
6	Q61115	0.0	2685	1434	0.938	0.946	PTC1_MOUSE Protein patched homolog 1 OS=Mus musculus OX=10090 GN=Ptch1 PE=1 SV=1
7	Q6UY90	0.0	2659	1434	0.937	0.946	Q6UY90_RAT Patched OS=Rattus norvegicus OX=10116 GN=Ptch1 PE=2 SV=1
8	Q98864	0.0	1481	1220	0.535	0.634	PTC1_DANRE Protein patched homolog 1 OS=Danio rerio OX=7955 GN=ptch1 PE=2 SV=1
9	Q9Y6C5	0.0	1273	1203	0.446	0.536	PTC2_HUMAN Protein patched homolog 2 OS=Homo sapiens OX=9606 GN=PTCH2 PE=1 SV=2
10	Q09614	5.54e-111	385	1408	0.143	0.147	PTC1_CAEEL Protein patched homolog 1 OS=Caenorhabditis elegans OX=6239 GN=ptc-1 PE=1 SV=2
11	H2L0G5	2.56e-94	336	1367	0.129	0.137	PTC3_CAEEL Protein patched homolog 3 OS=Caenorhabditis elegans OX=6239 GN=ptc-3 PE=1 SV=1
12	F4JTN1	2.06e-35	149	1297	0.057	0.064	F4JTN1_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1-2 PE=1 SV=1
13	F4I9G5	1.45e-34	147	1260	0.060	0.069	F4I9G5_ARATH Patched family protein OS=Arabidopsis thaliana OX=3702 GN=ATNPC1 PE=1 SV=2
14	B4DIP7	2.37e-29	129	776	0.053	0.099	B4DIP7_HUMAN cDNA FLJ57114, highly similar to Niemann-Pick C1 protein OS=Homo sapiens OX=9606 PE=2 SV=1
15	O15118	4.67e-29	129	1278	0.053	0.060	NPC1_HUMAN NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2
16	Q59GR1	4.74e-29	129	1289	0.053	0.060	Q59GR1_HUMAN Niemann-Pick disease, type C1 variant (Fragment) OS=Homo sapiens OX=9606 PE=3 SV=1
17	Q19945	1.49e-28	127	913	0.125	0.198	Q19945_CAEEL SSD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=daf-6 PE=4 SV=2
18	A0A0R4IZV0	5.55e-28	125	1271	0.087	0.099	A0A0R4IZV0_DANRE Niemann-Pick C1 protein precursor OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=2
19	F1QNG7	6.32e-28	125	1276	0.087	0.099	F1QNG7_DANRE Niemann-Pick C1 protein isoform X2 OS=Danio rerio OX=7955 GN=im:7149020 PE=1 SV=1
20	Q5BBG1	2.39e-27	123	1271	0.081	0.092	Q5BBG1_EMENI SSD domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02119 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02460 Patched	3.3e-70	248.9	Patched family
2	PF12349 Sterol-sensing	7.8e-40	147.7	Sterol-sensing domain of SREBP cleavage-activation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332353

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256442	0.999	G2/mitotic-specific cyclin-B1
2	9606.ENSP00000266991	0.999	Desert hedgehog protein
3	9606.ENSP00000295731	0.999	Indian hedgehog protein
4	9606.ENSP00000297261	0.999	Sonic hedgehog protein
5	9606.ENSP00000249373	0.998	Smoothened homolog
6	9606.ENSP00000376458	0.995	Cell adhesion molecule-related/down-regulated by oncogenes
7	9606.ENSP00000379258	0.994	Transcriptional activator GLI3
8	9606.ENSP00000298743	0.993	Growth arrest-specific protein 1
9	9606.ENSP00000312262	0.985	Beta-adrenergic receptor kinase 1
10	9606.ENSP00000228682	0.980	Zinc finger protein GLI1
11	9606.ENSP00000390436	0.976	Zinc finger protein GLI2
12	9606.ENSP00000377836	0.961	Glypican-3
13	9606.ENSP00000358918	0.958	Suppressor of fused homolog
14	9606.ENSP00000262375	0.942	DnaJ homolog subfamily A member 3, mitochondrial
15	9606.ENSP00000378699	0.940	Cyclin-dependent kinase 1
16	9606.ENSP00000418663	0.925	Brother of CDO
17	9606.ENSP00000296575	0.923	Hedgehog-interacting protein
18	9606.ENSP00000263816	0.919	Low-density lipoprotein receptor-related protein 2
19	9606.ENSP00000360944	0.915	SCL-interrupting locus protein
20	9606.ENSP00000262435	0.911	E3 ubiquitin-protein ligase SMURF2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030332	1.000	cyclin binding
GO:0015485	1.000	cholesterol binding
GO:0001664	0.997	G protein-coupled receptor binding
GO:0097108	0.959	hedgehog family protein binding
GO:0005119	0.954	smoothened binding
GO:0004888	0.322	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.994	multicellular organismal process
GO:0048856	0.994	anatomical structure development
GO:0009987	0.991	cellular process
GO:0050896	0.989	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0007275	0.975	multicellular organism development
GO:0048513	0.968	animal organ development
GO:0048731	0.962	system development
GO:0048519	0.935	negative regulation of biological process
GO:0023051	0.917	regulation of signaling
GO:0010646	0.917	regulation of cell communication
GO:0048583	0.915	regulation of response to stimulus
GO:0009966	0.910	regulation of signal transduction
GO:0048523	0.905	negative regulation of cellular process
GO:0009653	0.840	anatomical structure morphogenesis
GO:0042221	0.783	response to chemical
GO:0009968	0.743	negative regulation of signal transduction
GO:0051716	0.736	cellular response to stimulus
GO:0048518	0.717	positive regulation of biological process
GO:0050793	0.673	regulation of developmental process
GO:0048522	0.647	positive regulation of cellular process
GO:0048869	0.591	cellular developmental process
GO:0030154	0.584	cell differentiation
GO:0019222	0.534	regulation of metabolic process
GO:0060255	0.483	regulation of macromolecule metabolic process
GO:0007154	0.471	cell communication
GO:0031323	0.452	regulation of cellular metabolic process
GO:0023052	0.428	signaling
GO:0007165	0.421	signal transduction
GO:0051171	0.415	regulation of nitrogen compound metabolic process
GO:0080090	0.391	regulation of primary metabolic process
GO:0009893	0.373	positive regulation of metabolic process
GO:0051239	0.359	regulation of multicellular organismal process
GO:0010604	0.346	positive regulation of macromolecule metabolic process
GO:0008152	0.330	metabolic process
GO:0010468	0.326	regulation of gene expression
GO:0051173	0.316	positive regulation of nitrogen compound metabolic process
GO:0031325	0.315	positive regulation of cellular metabolic process
GO:0010033	0.314	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0120025	0.998	plasma membrane bounded cell projection
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005886	0.985	plasma membrane
GO:0005634	0.978	nucleus
GO:0005737	0.929	cytoplasm
GO:0043233	0.873	organelle lumen
GO:0070013	0.855	intracellular organelle lumen
GO:0005576	0.842	extracellular region
GO:0005929	0.723	cilium
GO:0012505	0.559	endomembrane system
GO:0031410	0.558	cytoplasmic vesicle
GO:0030054	0.539	cell junction
GO:0031090	0.467	organelle membrane
GO:0031981	0.386	nuclear lumen
GO:0030659	0.366	cytoplasmic vesicle membrane
GO:0005794	0.352	Golgi apparatus
GO:0030666	0.352	endocytic vesicle membrane
GO:0045177	0.342	apical part of cell
GO:0048471	0.327	perinuclear region of cytoplasm
GO:0043232	0.302	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]