StarFunc result for job id Q13641

User Input

>input (420 residues)
MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPD
QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL
AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL
NHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLD
LSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC
HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG
IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13641	1.000	1.000	5.129E-71	420	1.000	1.000	Q13641.pdb.gz	TPBG_HUMAN Trophoblast glycoprotein OS=Homo sapiens OX=9606 GN=TPBG PE=1 SV=1
2	AFDB:Q9Z0L0	0.715	0.705	1.366E-57	426	0.826	0.815	Q9Z0L0.pdb.gz	TPBG_MOUSE Trophoblast glycoprotein OS=Mus musculus OX=10090 GN=Tpbg PE=1 SV=3
3	AFDB:A0A0R4ITS3	0.602	0.676	4.426E-25	372	0.352	0.398	A0A0R4ITS3.pdb.gz	A0A0R4ITS3_DANRE Trophoblast glycoprotein a OS=Danio rerio OX=7955 GN=YF-296 PE=4 SV=1
4	AFDB:P91643	0.469	0.239	3.879E-16	880	0.210	0.100	P91643.pdb.gz	P91643_DROME KEK1 OS=Drosophila melanogaster OX=7227 GN=kek1 PE=1 SV=1
5	AFDB:Q9NT99	0.483	0.306	8.403E-15	713	0.233	0.137	Q9NT99.pdb.gz	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
6	AFDB:Q6NUI6	0.403	0.251	9.825E-15	762	0.236	0.130	Q6NUI6.pdb.gz	CHADL_HUMAN Chondroadherin-like protein OS=Homo sapiens OX=9606 GN=CHADL PE=1 SV=2
7	AFDB:F1QPB1	0.527	0.469	4.014E-14	479	0.212	0.186	F1QPB1.pdb.gz
8	AFDB:E9Q7T7	0.373	0.242	6.761E-14	748	0.229	0.128	E9Q7T7.pdb.gz	CHADL_MOUSE Chondroadherin-like protein OS=Mus musculus OX=10090 GN=Chadl PE=1 SV=1
9	AFDB:P24014	0.307	0.093	1.820E-13	1504	0.200	0.056	P24014.pdb.gz	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
10	AFDB:A0A287B8C4	0.359	0.231	2.020E-13	760	0.221	0.122	A0A287B8C4.pdb.gz	A0A287B8C4_PIG Chondroadherin like OS=Sus scrofa OX=9823 GN=CHADL PE=3 SV=2
11	PDB:7wv3A	0.372	0.260	5.287E-9	668	0.143	0.090	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
12	PDB:1xcdA	0.415	0.554	9.882E-9	305	0.150	0.207	1xcdA.pdb.gz
13	PDB:3t6qA	0.319	0.248	2.661E-8	601	0.152	0.106	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:5y31B	0.267	0.224	3.638E-8	511	0.138	0.114	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
15	PDB:3b2dA	0.355	0.267	1.207E-7	601	0.157	0.110	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:5yq5B	0.295	0.371	2.255E-7	306	0.136	0.186	5yq5B.pdb.gz
17	PDB:2ft3F	0.338	0.440	4.442E-7	305	0.133	0.184	2ft3F.pdb.gz
18	PDB:6gffI	0.244	0.200	3.056E-6	551	0.171	0.131	6gffI.pdb.gz
19	PDB:7tvfD	0.296	0.255	3.056E-6	515	0.131	0.107	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
20	PDB:7p5vB	0.399	0.241	7.812E-6	732	0.140	0.081	7p5vB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13641	0.0	848	420	1.000	1.000	TPBG_HUMAN Trophoblast glycoprotein OS=Homo sapiens OX=9606 GN=TPBG PE=1 SV=1
2	Q9Z0L0	0.0	650	426	0.826	0.815	TPBG_MOUSE Trophoblast glycoprotein OS=Mus musculus OX=10090 GN=Tpbg PE=1 SV=3
3	A0A0R4ITS3	1.46e-79	252	372	0.371	0.419	A0A0R4ITS3_DANRE Trophoblast glycoprotein a OS=Danio rerio OX=7955 GN=YF-296 PE=4 SV=1
4	Q80WD1	6.30e-26	110	420	0.240	0.240	R4RL2_RAT Reticulon-4 receptor-like 2 OS=Rattus norvegicus OX=10116 GN=Rtn4rl2 PE=1 SV=1
5	Q86UN3	6.48e-26	110	420	0.238	0.238	R4RL2_HUMAN Reticulon-4 receptor-like 2 OS=Homo sapiens OX=9606 GN=RTN4RL2 PE=1 SV=1
6	Q7M6Z0	6.25e-25	107	420	0.238	0.238	R4RL2_MOUSE Reticulon-4 receptor-like 2 OS=Mus musculus OX=10090 GN=Rtn4rl2 PE=1 SV=1
7	Q45R42	2.71e-24	107	652	0.219	0.141	LRRC4_RAT Leucine-rich repeat-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrrc4 PE=1 SV=1
8	Q9HBW1	4.08e-24	107	653	0.214	0.138	LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=LRRC4 PE=1 SV=2
9	Q99PH1	5.62e-24	106	652	0.214	0.138	LRRC4_MOUSE Leucine-rich repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Lrrc4 PE=1 SV=2
10	E9Q7T7	1.10e-23	105	748	0.252	0.142	CHADL_MOUSE Chondroadherin-like protein OS=Mus musculus OX=10090 GN=Chadl PE=1 SV=1
11	P0CC10	2.73e-23	104	709	0.260	0.154	LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1
12	P0C192	4.16e-23	104	709	0.252	0.150	LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1
13	P91643	1.21e-22	102	880	0.212	0.101	P91643_DROME KEK1 OS=Drosophila melanogaster OX=7227 GN=kek1 PE=1 SV=1
14	Q9VK54	1.26e-22	102	880	0.212	0.101	Q9VK54_DROME Kekkon 1, isoform B OS=Drosophila melanogaster OX=7227 GN=kek1 PE=4 SV=3
15	Q9NT99	3.31e-22	101	713	0.226	0.133	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
16	P24014	3.67e-22	101	1504	0.245	0.068	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
17	Q6NUI6	6.00e-22	100	762	0.245	0.135	CHADL_HUMAN Chondroadherin-like protein OS=Homo sapiens OX=9606 GN=CHADL PE=1 SV=2
18	Q6X3Y5	5.58e-21	97.1	479	0.210	0.184	Q6X3Y5_DANRE Reticulon-4 receptor precursor OS=Danio rerio OX=7955 GN=ngr PE=2 SV=1
19	Q6WZD1	1.58e-20	95.5	457	0.205	0.188	Q6WZD1_DANRE Nogo receptor homolog 1b OS=Danio rerio OX=7955 GN=ngrh1b PE=2 SV=1
20	Q99M75	2.72e-20	94.7	473	0.205	0.182	RTN4R_RAT Reticulon-4 receptor OS=Rattus norvegicus OX=10116 GN=Rtn4r PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01463 LRRCT	0.49	22.1	Leucine rich repeat C-terminal domain
2	PF01462 LRRNT	0.0022	28.8	Leucine rich repeat N-terminal domain
3	PF00560 LRR_1	8.9e-05	33.3	Leucine Rich Repeat
4	PF12799 LRR_4	1.2e-08	46.3	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	35	15.8	BspA type Leucine rich repeat region (6 copies)
6	PF13516 LRR_6	22	16.5	Leucine Rich repeat
7	PF13855 LRR_8	4.2e-34	127.4	Leucine rich repeat
8	PF14580 LRR_9	56	14.7	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358765

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376753	0.938	PDZ domain-containing protein GIPC1
2	9606.ENSP00000378786	0.800	HLA class II histocompatibility antigen, DR alpha chain
3	9606.ENSP00000359988	0.655	Serine/arginine-rich splicing factor 11
4	9606.ENSP00000380336	0.648	WD40 repeat-containing protein SMU1
5	9606.ENSP00000462333	0.645	Cytosolic endo-beta-N-acetylglucosaminidase
6	9606.ENSP00000219599	0.633	Ketimine reductase mu-crystallin
7	9606.ENSP00000312981	0.615	U4/U6.U5 tri-snRNP-associated protein 2
8	9606.ENSP00000356236	0.598	Synaptotagmin-2
9	9606.ENSP00000268150	0.592	Lactadherin
10	9606.ENSP00000356545	0.584	Voltage-dependent R-type calcium channel subunit alpha-1E
11	9606.ENSP00000361087	0.560	Gamma-synuclein
12	9606.ENSP00000355180	0.559	Collagen alpha-1(VI) chain
13	9606.ENSP00000322460	0.557	Sodium channel subunit beta-4
14	9606.ENSP00000480476	0.553	5-oxoprolinase
15	9606.ENSP00000264661	0.528	Potassium voltage-gated channel subfamily H member 4
16	9606.ENSP00000434241	0.525	Potassium voltage-gated channel subfamily C member 3
17	9606.ENSP00000256999	0.510	Glutamate carboxypeptidase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.561	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048583	0.952	regulation of response to stimulus
GO:0048518	0.937	positive regulation of biological process
GO:0023051	0.937	regulation of signaling
GO:0010646	0.937	regulation of cell communication
GO:0048522	0.878	positive regulation of cellular process
GO:0009966	0.838	regulation of signal transduction
GO:0050896	0.797	response to stimulus
GO:0051179	0.776	localization
GO:0032501	0.739	multicellular organismal process
GO:0048519	0.708	negative regulation of biological process
GO:0023056	0.653	positive regulation of signaling
GO:0010647	0.653	positive regulation of cell communication
GO:0051239	0.645	regulation of multicellular organismal process
GO:0048584	0.644	positive regulation of response to stimulus
GO:0032502	0.629	developmental process
GO:0050793	0.589	regulation of developmental process
GO:0048856	0.580	anatomical structure development
GO:0048523	0.543	negative regulation of cellular process
GO:0007154	0.503	cell communication
GO:0023052	0.497	signaling
GO:0009967	0.419	positive regulation of signal transduction
GO:0065008	0.416	regulation of biological quality
GO:2000026	0.395	regulation of multicellular organismal development
GO:1902531	0.387	regulation of intracellular signal transduction
GO:0051128	0.345	regulation of cellular component organization
GO:0007275	0.341	multicellular organism development
GO:1902533	0.321	positive regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.809	organelle
GO:0005622	0.722	intracellular anatomical structure
GO:0043227	0.669	membrane-bounded organelle
GO:0043231	0.568	intracellular membrane-bounded organelle
GO:0005737	0.453	cytoplasm
GO:0009986	0.400	cell surface
GO:0012505	0.330	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]