StarFunc result for job id Q13642

User Input

>input (323 residues)
MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRF
WHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGT
VWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQP
WHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGKRTVSRVSHP
VSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLYRKNRSLAAPRGPGLVK
APVWWPMKDNPGTTTASTAKNAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13642	1.000	1.000	2.547E-65	323	1.000	1.000	Q13642.pdb.gz	FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=4
2	AFDB:A0A494C0D6	0.678	0.843	8.205E-46	257	0.715	0.899	A0A494C0D6.pdb.gz	A0A494C0D6_HUMAN Four and a half LIM domains 1 OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
3	AFDB:P97447	0.683	0.784	4.109E-44	280	0.672	0.775	P97447.pdb.gz	FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus OX=10090 GN=Fhl1 PE=1 SV=3
4	AFDB:Q6GQL7	0.456	0.490	6.057E-36	297	0.492	0.535	Q6GQL7.pdb.gz	Q6GQL7_DANRE Fhla protein OS=Danio rerio OX=7955 GN=fhla PE=1 SV=1
5	AFDB:B0JZK9	0.630	0.717	6.266E-35	280	0.418	0.482	B0JZK9.pdb.gz
6	AFDB:Q5JXI2	0.506	0.773	1.519E-32	210	0.517	0.795	Q5JXI2.pdb.gz	Q5JXI2_HUMAN Four and a half LIM domains 1 OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
7	AFDB:O35115	0.497	0.559	1.256E-29	279	0.365	0.423	O35115.pdb.gz	FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus OX=10116 GN=Fhl2 PE=1 SV=1
8	AFDB:Q9R059	0.416	0.459	2.776E-28	289	0.331	0.370	Q9R059.pdb.gz	FHL3_MOUSE Four and a half LIM domains protein 3 OS=Mus musculus OX=10090 GN=Fhl3 PE=1 SV=2
9	AFDB:Q9WTX7	0.495	0.551	3.718E-28	284	0.347	0.394	Q9WTX7.pdb.gz	FHL5_MOUSE Four and a half LIM domains protein 5 OS=Mus musculus OX=10090 GN=Fhl5 PE=1 SV=1
10	AFDB:Q5TD97	0.505	0.562	4.697E-28	284	0.331	0.377	Q5TD97.pdb.gz	FHL5_HUMAN Four and a half LIM domains protein 5 OS=Homo sapiens OX=9606 GN=FHL5 PE=1 SV=1
11	PDB:4kfzB	0.193	0.382	2.305E-7	148	0.096	0.209	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.176	0.280	2.680E-6	192	0.121	0.203	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.158	0.532	4.734E-3	76	0.053	0.224	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:6oq5A	0.066	0.018	3.783E-1	2346	0.074	0.010	6oq5A.pdb.gz	Structure of the full-length Clostridium difficile toxin B.
15	PDB:5a31B	0.073	0.184	6.785E-1	84	0.034	0.131	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
16	PDB:4zynB	0.096	0.083	9.632E-1	385	0.121	0.101	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.
17	PDB:4kblA	0.113	0.096	1.083	395	0.090	0.073	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
18	PDB:7uhyA	0.059	0.032	1.083	771	0.065	0.027	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:4r8pL	0.103	0.127	1.148	254	0.046	0.059	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:7a1gM	0.076	0.395	1.290	53	0.022	0.132	7a1gM.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13642	0.0	664	323	1.000	1.000	FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=4
2	Q5JXI8	9.90e-170	473	257	0.712	0.895	Q5JXI8_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
3	A0A494C0D6	8.20e-169	471	257	0.709	0.891	A0A494C0D6_HUMAN Four and a half LIM domains 1 OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
4	P97447	3.13e-162	455	280	0.703	0.811	FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus OX=10090 GN=Fhl1 PE=1 SV=3
5	Q5JXI3	2.05e-152	427	207	0.641	1.000	Q5JXI3_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
6	Q5JXH7	1.56e-150	422	205	0.635	1.000	Q5JXH7_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
7	Q5JXH8	1.06e-149	420	204	0.632	1.000	Q5JXH8_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
8	A0A0D9SFZ9	1.98e-126	360	175	0.542	1.000	A0A0D9SFZ9_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
9	Q5JXI2	2.11e-121	349	210	0.523	0.805	Q5JXI2_HUMAN Four and a half LIM domains 1 OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
10	Q6GQL7	1.84e-112	330	297	0.492	0.535	Q6GQL7_DANRE Fhla protein OS=Danio rerio OX=7955 GN=fhla PE=1 SV=1
11	A0A140LFQ9	3.32e-112	328	281	0.492	0.566	A0A140LFQ9_DANRE Four and a half LIM domains 1a OS=Danio rerio OX=7955 GN=fhl PE=1 SV=1
12	Q5JXH9	1.40e-111	322	155	0.480	1.000	Q5JXH9_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
13	A0A0D9SFB0	4.26e-109	315	152	0.471	1.000	A0A0D9SFB0_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
14	A0A0D9SFI6	3.86e-105	305	147	0.455	1.000	A0A0D9SFI6_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
15	Q5JXI0	3.07e-100	293	141	0.437	1.000	Q5JXI0_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
16	F1Q7A2	1.00e-99	296	280	0.418	0.482	F1Q7A2_DANRE Four and a half LIM domains 1b OS=Danio rerio OX=7955 GN=cb1039 PE=4 SV=1
17	Q7T327	1.46e-99	296	280	0.418	0.482	Q7T327_DANRE Four and a half LIM domains OS=Danio rerio OX=7955 GN=fhl PE=2 SV=1
18	A0A0D9SGB2	8.23e-98	286	138	0.427	1.000	A0A0D9SGB2_HUMAN Four and a half LIM domains 1 (Fragment) OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=1
19	O35115	7.58e-83	253	279	0.365	0.423	FHL2_RAT Four and a half LIM domains protein 2 OS=Rattus norvegicus OX=10116 GN=Fhl2 PE=1 SV=1
20	Q14192	2.35e-82	252	279	0.362	0.419	FHL2_HUMAN Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00412 LIM	2.9e-33	125.2	LIM domain
2	PF04115 Ureidogly_lyase	69	14.6	Ureidoglycolate lyase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005594741.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005554682.1	0.976	Recombination signal binding protein for immunoglobulin kappa J region
2	9541.XP_005561516.1	0.700	Uncharacterized protein
3	9541.XP_005563764.1	0.663	Belongs to the small GTPase superfamily. RGK family.
4	9541.XP_005541311.1	0.617	Vang-like protein 2 isoform X2
5	9541.XP_005542277.1	0.617	VANGL planar cell polarity protein 1
6	9541.XP_005584300.1	0.603	Signal transducer and activator of transcription
7	9541.XP_005571290.1	0.601	Signal transducer and activator of transcription 2
8	9541.XP_005571343.1	0.601	Signal transducer and activator of transcription 6 isoform X1
9	9541.XP_005573832.1	0.601	Signal transducer and activator of transcription 1-alpha/beta isoform X1
10	9541.XP_005573833.1	0.601	Signal transducer and activator of transcription 4 isoform X1
11	9541.XP_005584292.1	0.601	Signal transducer and activator of transcription
12	9541.XP_005545156.1	0.597	Segment polarity protein dishevelled homolog DVL-1 isoform X1
13	9541.XP_005546577.1	0.597	Segment polarity protein dishevelled homolog DVL-3 isoform X1
14	9541.XP_005553387.1	0.597	E3 ubiquitin-protein ligase RING1
15	9541.XP_005582770.1	0.597	Segment polarity protein dishevelled-like protein DVL-2
16	9541.XP_005566831.1	0.593	Uncharacterized protein
17	9541.XP_005584570.1	0.579	Rho GTPase-activating protein 27 isoform X1
18	9541.XP_005572865.1	0.575	Uncharacterized protein LOC102136064
19	9541.XP_005540817.1	0.573	Serine/threonine-protein kinase Nek2 isoform X1
20	9541.XP_005554442.1	0.566	Actin-binding LIM protein 2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	0.996	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.960	biological regulation
GO:0050789	0.951	regulation of biological process
GO:0050794	0.910	regulation of cellular process
GO:0009987	0.820	cellular process
GO:0065009	0.809	regulation of molecular function
GO:0032879	0.667	regulation of localization
GO:0048518	0.652	positive regulation of biological process
GO:0048519	0.632	negative regulation of biological process
GO:0048523	0.621	negative regulation of cellular process
GO:0065008	0.571	regulation of biological quality
GO:1902749	0.547	regulation of cell cycle G2/M phase transition
GO:0032409	0.531	regulation of transporter activity
GO:1901990	0.527	regulation of mitotic cell cycle phase transition
GO:0010948	0.527	negative regulation of cell cycle process
GO:0010959	0.524	regulation of metal ion transport
GO:0051128	0.510	regulation of cellular component organization
GO:1901991	0.509	negative regulation of mitotic cell cycle phase transition
GO:0034762	0.503	regulation of transmembrane transport
GO:0071840	0.497	cellular component organization or biogenesis
GO:1902806	0.494	regulation of cell cycle G1/S phase transition
GO:0016043	0.493	cellular component organization
GO:0043266	0.493	regulation of potassium ion transport
GO:0032501	0.475	multicellular organismal process
GO:0048856	0.427	anatomical structure development
GO:0042391	0.414	regulation of membrane potential
GO:0032412	0.414	regulation of monoatomic ion transmembrane transporter activity
GO:1904062	0.410	regulation of monoatomic cation transmembrane transport
GO:0040008	0.406	regulation of growth
GO:2000045	0.405	regulation of G1/S transition of mitotic cell cycle
GO:1901379	0.394	regulation of potassium ion transmembrane transport
GO:1902807	0.394	negative regulation of cell cycle G1/S phase transition
GO:0048522	0.378	positive regulation of cellular process
GO:0003254	0.376	regulation of membrane depolarization
GO:1902750	0.376	negative regulation of cell cycle G2/M phase transition
GO:2000134	0.376	negative regulation of G1/S transition of mitotic cell cycle
GO:0050896	0.350	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0071944	0.995	cell periphery
GO:0016020	0.995	membrane
GO:0005886	0.994	plasma membrane
GO:0005634	0.970	nucleus
GO:0043232	0.823	intracellular non-membrane-bounded organelle
GO:0030054	0.554	cell junction
GO:0070161	0.497	anchoring junction
GO:0030055	0.390	cell-substrate junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]