StarFunc result for job id Q13683

User Input

>input (1181 residues)
MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAH
LDDGPYEAGGEKEQDPRLIPVPANSYFGLLFVTNIDSSDPDQLVYKTLDPADRLPGPAGD
LALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVMLSGERL
TSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLNQGGHWAGISPLRLCGS
PDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVAKPSQVLEGEAVGI
KSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPILHVSHEVSIAPRSIDLEQPNCA
GGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQ
ASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIVVTLSYSLQTPRLRRQAPGQGLPPVAP
ILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCTRVSDTEFQPLPMDVDGTTAL
FALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGVRALDPAEKPL
CLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELEVELLLATISEQELHPVS
ARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTVSNQGQSLRTL
GSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDVDSRDRRRREL
EPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVW
GRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVIPVMVYLDPMAVVAEGV
PWWVILLAVLAGLLVLALLVLLLWKMGFFKRAKHPEATVPQYHAVKIPREDRQQFKEEKT
GTILRNNWGSPRREGPDAHPILAADGHPELGPDGHPGPGTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8WHQ8	0.606	0.653	0.000	1092	0.442	0.478	A8WHQ8.pdb.gz	A8WHQ8_DANRE Integrin alpha-6 isoform X1 OS=Danio rerio OX=7955 GN=itga6a PE=1 SV=1
2	AFDB:P23229	0.547	0.571	0.000	1130	0.469	0.490	P23229.pdb.gz	ITA6_HUMAN Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6 PE=1 SV=5
3	AFDB:P26007	0.705	0.771	0.000	1072	0.429	0.473	P26007.pdb.gz	ITA6_CHICK Integrin alpha-6 OS=Gallus gallus OX=9031 GN=ITGA6 PE=2 SV=1
4	AFDB:Q13683	1.000	1.000	0.000	1181	1.000	1.000	Q13683.pdb.gz	ITA7_HUMAN Integrin alpha-7 OS=Homo sapiens OX=9606 GN=ITGA7 PE=1 SV=3
5	AFDB:Q61738	0.619	0.620	0.000	1179	0.871	0.873	Q61738.pdb.gz	ITA7_MOUSE Integrin alpha-7 OS=Mus musculus OX=10090 GN=Itga7 PE=1 SV=3
6	AFDB:Q61739	0.763	0.823	0.000	1091	0.461	0.500	Q61739.pdb.gz	ITA6_MOUSE Integrin alpha-6 OS=Mus musculus OX=10090 GN=Itga6 PE=1 SV=3
7	AFDB:Q63258	0.611	0.634	0.000	1135	0.839	0.873	Q63258.pdb.gz	ITA7_RAT Integrin alpha-7 OS=Rattus norvegicus OX=10116 GN=Itga7 PE=1 SV=2
8	AFDB:D3ZQM3	0.532	0.584	8.286E-104	1067	0.350	0.387	D3ZQM3.pdb.gz	D3ZQM3_RAT Integrin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Itga3 PE=3 SV=2
9	AFDB:Q62470	0.488	0.541	5.777E-103	1053	0.342	0.384	Q62470.pdb.gz	ITA3_MOUSE Integrin alpha-3 OS=Mus musculus OX=10090 GN=Itga3 PE=1 SV=1
10	AFDB:D7PS99	0.494	0.556	3.427E-102	1041	0.312	0.354	D7PS99.pdb.gz	D7PS99_DANRE Integrin alpha 3 protein OS=Danio rerio OX=7955 GN=im:7155971 PE=1 SV=1
11	PDB:4g1eA	0.437	0.529	4.429E-73	964	0.232	0.284	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
12	PDB:3fcsA	0.411	0.522	5.410E-69	913	0.218	0.283	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
13	PDB:7nxdA	0.432	0.556	1.553E-67	905	0.224	0.293	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
14	PDB:7uslA	0.399	0.538	2.463E-56	856	0.178	0.245	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
15	PDB:4nehA	0.407	0.442	2.653E-54	1084	0.194	0.211	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
16	PDB:4nenA	0.403	0.445	2.247E-53	1063	0.199	0.221	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
17	PDB:3k6sC	0.406	0.530	6.451E-52	885	0.186	0.249	3k6sC.pdb.gz	Structure of an integrin with an alphaI domain, complement receptor type 4.
18	PDB:7sqcO0	0.125	0.129	1.765E-9	1140	0.050	0.052	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:7u05A	0.089	0.092	1.332E-7	1114	0.039	0.041	7u05A.pdb.gz
20	PDB:7dvq3	0.165	0.164	2.331E-7	1193	0.072	0.071	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A5C8	948	1073	0.414	0.456	A0A8I6A5C8_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
2	A0A8I6AJE9	1095	1129	0.475	0.497	A0A8I6AJE9_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
3	A0A8I6G9S4	1022	1061	0.451	0.502	A0A8I6G9S4_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
4	A0A8I6GLI8	585	1050	0.358	0.403	A0A8I6GLI8_RAT Integrin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Itga3 PE=3 SV=1
5	A8WHQ7	981	1071	0.439	0.485	A8WHQ7_DANRE Integrin alpha-6 isoform X2 OS=Danio rerio OX=7955 GN=itga6a PE=1 SV=1
6	A8WHQ8	997	1092	0.445	0.482	A8WHQ8_DANRE Integrin alpha-6 isoform X1 OS=Danio rerio OX=7955 GN=itga6a PE=1 SV=1
7	D3ZCG9	600	1052	0.361	0.405	D3ZCG9_RAT Integrin alpha 3 variant A OS=Rattus norvegicus OX=10116 GN=Itga3 PE=2 SV=1
8	D3ZQM3	577	1055	0.339	0.379	D3ZQM3_RAT Integrin subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Itga3 PE=3 SV=2
9	D7PS99	568	1041	0.339	0.384	D7PS99_DANRE Integrin alpha 3 protein OS=Danio rerio OX=7955 GN=im:7155971 PE=1 SV=1
10	F1R2R3	568	1041	0.336	0.381	F1R2R3_DANRE Integrin alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=im:7145180 PE=1 SV=1
11	G3V667	1022	1073	0.455	0.500	G3V667_RAT Integrin subunit alpha 6 OS=Rattus norvegicus OX=10116 GN=Itga6 PE=1 SV=1
12	I4DUB5	606	1067	0.359	0.397	I4DUB5_RAT Integrin alpha 3 variant B OS=Rattus norvegicus OX=10116 GN=Itga3 PE=2 SV=1
13	P23229	1116	1130	0.472	0.494	ITA6_HUMAN Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6 PE=1 SV=5
14	P26007	1014	1072	0.439	0.483	ITA6_CHICK Integrin alpha-6 OS=Gallus gallus OX=9031 GN=ITGA6 PE=2 SV=1
15	Q13683	2419	1181	1.000	1.000	ITA7_HUMAN Integrin alpha-7 OS=Homo sapiens OX=9606 GN=ITGA7 PE=1 SV=3
16	Q61738	2051	1179	0.870	0.871	ITA7_MOUSE Integrin alpha-7 OS=Mus musculus OX=10090 GN=Itga7 PE=1 SV=3
17	Q61739	1050	1091	0.461	0.499	ITA6_MOUSE Integrin alpha-6 OS=Mus musculus OX=10090 GN=Itga6 PE=1 SV=3
18	Q62470	593	1053	0.357	0.401	ITA3_MOUSE Integrin alpha-3 OS=Mus musculus OX=10090 GN=Itga3 PE=1 SV=1
19	Q63258	1942	1135	0.842	0.876	ITA7_RAT Integrin alpha-7 OS=Rattus norvegicus OX=10116 GN=Itga7 PE=1 SV=2
20	Q924W2	937	974	0.412	0.499	Q924W2_RAT Integrin alpha 6 subchain (Fragment) OS=Rattus norvegicus OX=10116 GN=Itga6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01839 FG-GAP	9.7e-21	84.5	FG-GAP repeat
2	PF13517 FG-GAP_3	1.7e-11	55.9	FG-GAP-like repeat
3	PF00357 Integrin_alpha	4	18.7	Integrin alpha cytoplasmic region
4	PF08441 Integrin_alpha2	5.5e-119	409.9	Integrin alpha
5	PF11992 TgpA_N	8.7	16.9	TgpA N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000008606

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000004110	0.990	Integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)
2	9598.ENSPTRP00000016404	0.969	Integrin, beta 4
3	9598.ENSPTRP00000021483	0.957	Integrin, beta 6
4	9598.ENSPTRP00000051108	0.940	Belongs to the integrin beta chain family.
5	9598.ENSPTRP00000032396	0.937	Belongs to the integrin beta chain family.
6	9598.ENSPTRP00000008519	0.933	Belongs to the integrin beta chain family.
7	9598.ENSPTRP00000016876	0.931	Laminin, alpha 3
8	9598.ENSPTRP00000016769	0.930	Laminin, alpha 1
9	9598.ENSPTRP00000033536	0.913	Uncharacterized protein
10	9598.ENSPTRP00000031732	0.912	Uncharacterized protein
11	9598.ENSPTRP00000035264	0.908	Belongs to the protein kinase superfamily. Tyr protein kinase family
12	9598.ENSPTRP00000002939	0.893	Uncharacterized protein
13	9598.ENSPTRP00000025746	0.892	Uncharacterized protein
14	9598.ENSPTRP00000036381	0.891	Uncharacterized protein
15	9598.ENSPTRP00000031624	0.889	Uncharacterized protein
16	9598.ENSPTRP00000047144	0.879	Laminin, gamma 3
17	9598.ENSPTRP00000002941	0.834	Laminin, gamma 2
18	9598.ENSPTRP00000040144	0.825	Uncharacterized protein
19	9598.ENSPTRP00000012209	0.822	Talin 2
20	9598.ENSPTRP00000056703	0.822	Talin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.968	protein-containing complex binding
GO:0005102	0.881	signaling receptor binding
GO:0050839	0.873	cell adhesion molecule binding
GO:0050840	0.785	extracellular matrix binding
GO:0043236	0.730	laminin binding
GO:0005178	0.681	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0032502	0.995	developmental process
GO:0048856	0.994	anatomical structure development
GO:0032501	0.987	multicellular organismal process
GO:0007155	0.966	cell adhesion
GO:0065007	0.953	biological regulation
GO:0050789	0.929	regulation of biological process
GO:0050794	0.922	regulation of cellular process
GO:0007275	0.922	multicellular organism development
GO:0009653	0.878	anatomical structure morphogenesis
GO:0048731	0.763	system development
GO:0009888	0.744	tissue development
GO:0048513	0.600	animal organ development
GO:0050896	0.577	response to stimulus
GO:0031589	0.519	cell-substrate adhesion
GO:0048646	0.504	anatomical structure formation involved in morphogenesis
GO:0030154	0.455	cell differentiation
GO:0051716	0.430	cellular response to stimulus
GO:0048518	0.428	positive regulation of biological process
GO:0048522	0.395	positive regulation of cellular process
GO:0007154	0.316	cell communication
GO:0098609	0.310	cell-cell adhesion
GO:0016477	0.305	cell migration
GO:0007165	0.305	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.977	protein-containing complex
GO:0009986	0.970	cell surface
GO:0005622	0.811	intracellular anatomical structure
GO:0005576	0.791	extracellular region
GO:0030054	0.784	cell junction
GO:0005737	0.737	cytoplasm
GO:0098797	0.636	plasma membrane protein complex
GO:0098636	0.580	protein complex involved in cell adhesion
GO:0008305	0.535	integrin complex
GO:0043226	0.525	organelle
GO:0043227	0.486	membrane-bounded organelle
GO:0043231	0.328	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]