StarFunc result for job id Q13686

User Input

>input (389 residues)
MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQ
KVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLK
LYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWD
SKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHS
KPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEG
LPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIED
EKRDISTEGFCHLDDQNSEVKRARINPDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13686	1.000	1.000	1.749E-83	389	1.000	1.000	Q13686.pdb.gz	ALKB1_HUMAN Nucleic acid dioxygenase ALKBH1 OS=Homo sapiens OX=9606 GN=ALKBH1 PE=1 SV=2
2	AFDB:P0CB42	0.848	0.848	2.753E-62	389	0.828	0.828	P0CB42.pdb.gz	ALKB1_MOUSE Nucleic acid dioxygenase ALKBH1 OS=Mus musculus OX=10090 GN=Alkbh1 PE=1 SV=1
3	PDB:6ie2F	0.815	0.975	3.805E-60	324	0.833	1.000	6ie2F.pdb.gz	Structural basis of nucleic acid recognition and 6mA demethylation by human ALKBH1.
4	PDB:6imcD	0.839	0.957	2.363E-56	340	0.740	0.847	6imcD.pdb.gz	Mammalian ALKBH1 serves as an N6-mA demethylase of unpairing DNA.
5	AFDB:Q57US9	0.623	0.743	2.638E-24	323	0.221	0.266	Q57US9.pdb.gz	Q57US9_TRYB2 Alkylated DNA repair protein (AlkB homolog), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.580 PE=4 SV=1
6	AFDB:O60066	0.610	0.775	2.846E-22	302	0.224	0.288	O60066.pdb.gz	ALKBH_SCHPO Alpha-ketoglutarate-dependent dioxygenase abh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abh1 PE=2 SV=3
7	AFDB:P05050	0.381	0.658	3.504E-12	216	0.126	0.227	P05050.pdb.gz	ALKB_ECOLI Alpha-ketoglutarate-dependent dioxygenase AlkB OS=Escherichia coli (strain K12) OX=83333 GN=alkB PE=1 SV=1
8	PDB:2fdjA	0.335	0.606	7.085E-12	207	0.113	0.213	2fdjA.pdb.gz	Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
9	AFDB:Q9U3P9	0.297	0.200	3.436E-8	591	0.085	0.056	Q9U3P9.pdb.gz	Q9U3P9_CAEEL Alkylated DNA repair protein alkB homolog 8 OS=Caenorhabditis elegans OX=6239 GN=alkb-8 PE=1 SV=2
10	AFDB:Q5RJC7	0.274	0.210	4.235E-7	520	0.108	0.081	Q5RJC7.pdb.gz	Q5RJC7_ARATH At4g36090 OS=Arabidopsis thaliana OX=3702 GN=ALKBH9C PE=1 SV=1
11	AFDB:Q8MNT9	0.298	0.390	6.316E-7	291	0.062	0.082	Q8MNT9.pdb.gz	NMAD1_CAEEL DNA N6-methyl adenine demethylase OS=Caenorhabditis elegans OX=6239 GN=nmad-1 PE=1 SV=1
12	PDB:7vjvA	0.283	0.465	1.139E-6	221	0.087	0.154	7vjvA.pdb.gz	Structural insights into the interactions and epigenetic functions of human nucleic acid repair protein ALKBH6.
13	AFDB:Q9SL49	0.300	0.233	1.183E-6	507	0.082	0.063	Q9SL49.pdb.gz	AKB9B_ARATH RNA demethylase ALKBH9B OS=Arabidopsis thaliana OX=3702 GN=ALKBH9B PE=1 SV=1
14	AFDB:Q1ECQ5	0.332	0.549	1.487E-6	226	0.080	0.137	Q1ECQ5.pdb.gz	Q1ECQ5_ARATH 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g02485 PE=1 SV=1
15	PDB:4ie6A	0.237	0.209	3.123E-5	447	0.090	0.078	4ie6A.pdb.gz	Structural basis for inhibition of the fat mass and obesity associated protein (FTO)
16	PDB:5zmdG	0.198	0.191	1.301E-4	403	0.049	0.047	5zmdG.pdb.gz	Structural insights into FTO's catalytic mechanism for the demethylation of multiple RNA substrates.
17	PDB:4qkbA	0.289	0.536	2.733E-4	190	0.057	0.116	4qkbA.pdb.gz	The atomic resolution structure of human AlkB homolog 7 (ALKBH7), a key protein for programmed necrosis and fat metabolism
18	PDB:6ku3B	0.220	0.263	8.562E-4	318	0.072	0.088	6ku3B.pdb.gz	A common allosteric mechanism regulates homeostatic inactivation of auxin and gibberellin.
19	PDB:4q5oA	0.288	0.376	2.016E-3	282	0.077	0.106	4q5oA.pdb.gz	Crystal structure of the ectoine hydroxylase, a snapshot of the active site.
20	PDB:2vqaA	0.181	0.197	4.234E-3	356	0.026	0.028	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CB42	0.0	686	389	0.828	0.828	ALKB1_MOUSE Nucleic acid dioxygenase ALKBH1 OS=Mus musculus OX=10090 GN=Alkbh1 PE=1 SV=1
2	Q13686	0.0	816	389	1.000	1.000	ALKB1_HUMAN Nucleic acid dioxygenase ALKBH1 OS=Homo sapiens OX=9606 GN=ALKBH1 PE=1 SV=2
3	O60066	8.22e-32	124	302	0.157	0.202	ALKBH_SCHPO Alpha-ketoglutarate-dependent dioxygenase abh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abh1 PE=2 SV=3
4	Q57US9	4.32e-26	108	323	0.229	0.276	Q57US9_TRYB2 Alkylated DNA repair protein (AlkB homolog), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.580 PE=4 SV=1
5	P05050	2.48e-13	70.9	216	0.085	0.153	ALKB_ECOLI Alpha-ketoglutarate-dependent dioxygenase AlkB OS=Escherichia coli (strain K12) OX=83333 GN=alkB PE=1 SV=1
6	O01805	0.53	32.3	86	0.046	0.209	ACBP1_CAEEL Acyl-CoA-binding protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=acbp-1 PE=3 SV=1
7	F4I9F1	2.1	33.1	1161	0.069	0.023	F4I9F1_ARATH ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase OS=Arabidopsis thaliana OX=3702 GN=At1g31540 PE=1 SV=1
8	Q389C9	2.5	32.7	791	0.046	0.023	Q389C9_TRYB2 Acyltransferase 3 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1600 PE=4 SV=1
9	Q9CWG8	5.7	31.6	436	0.082	0.073	NDUF7_MOUSE Protein arginine methyltransferase NDUFAF7, mitochondrial OS=Mus musculus OX=10090 GN=Ndufaf7 PE=1 SV=4
10	Q5T1H1	7.3	31.6	3165	0.093	0.011	EYS_HUMAN Protein eyes shut homolog OS=Homo sapiens OX=9606 GN=EYS PE=1 SV=5
11	H0YG38	9.8	30.8	367	0.033	0.035	H0YG38_HUMAN Pre-mRNA processing factor 40 homolog A (Fragment) OS=Homo sapiens OX=9606 GN=PRPF40A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13532 2OG-FeII_Oxy_2	1.2e-33	128.4	2OG-Fe(II) oxygenase superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216489

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398181	0.963	DNA oxidative demethylase ALKBH2
2	9606.ENSP00000355720	0.955	JmjC domain-containing protein 4
3	9606.ENSP00000302232	0.948	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3
4	9606.ENSP00000397673	0.941	Alkylated DNA repair protein alkB homolog 8
5	9606.ENSP00000382091	0.923	RNA demethylase ALKBH5
6	9606.ENSP00000292566	0.918	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4
7	9606.ENSP00000245812	0.898	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial
8	9606.ENSP00000418823	0.870	Alpha-ketoglutarate-dependent dioxygenase FTO
9	9606.ENSP00000368152	0.848	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6
10	9606.ENSP00000203001	0.824	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6
11	9606.ENSP00000298717	0.813	N6-adenosine-methyltransferase catalytic subunit
12	9606.ENSP00000373474	0.804	N6-adenosine-methyltransferase non-catalytic subunit
13	9606.ENSP00000351141	0.798	Pre-mRNA-splicing regulator WTAP
14	9606.ENSP00000302111	0.787	Methylated-DNA--protein-cysteine methyltransferase
15	9606.ENSP00000262177	0.783	DnaJ homolog subfamily B member 6
16	9606.ENSP00000339245	0.768	YTH domain-containing protein 1
17	9606.ENSP00000359364	0.762	YTH domain-containing family protein 1
18	9606.ENSP00000362918	0.759	YTH domain-containing family protein 2
19	9606.ENSP00000318986	0.746	tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial
20	9606.ENSP00000297591	0.721	Protein virilizer homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008198	1.000	ferrous iron binding
GO:0035516	1.000	oxidative DNA demethylase activity
GO:0140101	0.999	catalytic activity, acting on a tRNA
GO:0003906	0.999	DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0000049	0.999	tRNA binding
GO:0016835	0.997	carbon-oxygen lyase activity
GO:0005515	0.996	protein binding
GO:0035515	0.957	oxidative RNA demethylase activity
GO:0048018	0.946	receptor ligand activity
GO:0042056	0.943	chemoattractant activity
GO:0140078	0.857	class I DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:1990984	0.855	tRNA demethylase activity
GO:0070579	0.846	methylcytosine dioxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0090304	0.983	nucleic acid metabolic process
GO:0043412	0.981	macromolecule modification
GO:0019222	0.967	regulation of metabolic process
GO:0060255	0.962	regulation of macromolecule metabolic process
GO:0010468	0.940	regulation of gene expression
GO:0044260	0.937	cellular macromolecule metabolic process
GO:0016070	0.933	RNA metabolic process
GO:0034470	0.916	ncRNA processing
GO:0009451	0.894	RNA modification
GO:0006400	0.873	tRNA modification
GO:0051171	0.729	regulation of nitrogen compound metabolic process
GO:0080090	0.727	regulation of primary metabolic process
GO:0031323	0.691	regulation of cellular metabolic process
GO:0050896	0.674	response to stimulus
GO:0006974	0.660	cellular response to DNA damage stimulus
GO:0006259	0.659	DNA metabolic process
GO:0006304	0.636	DNA modification
GO:0070988	0.596	demethylation
GO:0051246	0.588	regulation of protein metabolic process
GO:0035510	0.574	DNA dealkylation
GO:0010556	0.553	regulation of macromolecule biosynthetic process
GO:0031326	0.553	regulation of cellular biosynthetic process
GO:0006281	0.440	DNA repair
GO:0010608	0.423	post-transcriptional regulation of gene expression
GO:0006417	0.413	regulation of translation
GO:0048519	0.301	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0005737	0.964	cytoplasm
GO:0012505	0.958	endomembrane system
GO:0005739	0.904	mitochondrion
GO:0005694	0.444	chromosome
GO:0005783	0.439	endoplasmic reticulum
GO:0000785	0.406	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:30299	1.000	2-oxoglutarate + a methylated nucleobase within DNA + O2 = a nucleobase within DNA + CO2 + formaldehyde + succinate
EC:1.14.11.33	1.000	DNA oxidative demethylase.
EC:4.2.-.-	0.997	Carbon-oxygen lyases.
RHEA:66592	0.857	2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+)
EC:4.2.99.18	0.857	DNA-(apurinic or apyrimidinic site) lyase.
RHEA:52636	0.846	2-oxoglutarate + a 5-methyl-2'-deoxycytidine in DNA + O2 = a 5-hydroxymethyl-2'-deoxycytidine in DNA + CO2 + succinate
EC:1.14.11.n2	0.846	Transferred entry: 1.14.11.80.

[back to server]