StarFunc result for job id Q13702

User Input

>input (412 residues)
MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYK
EMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQ
LGGQVSLSMGNAFLGLSVFQKALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYE
KALFFPCKAAELVNNYGKGWSLKYRAMSQYHMAVAYRLLGRLGSAMECCEESMKIALQHG
DRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARK
ALDKALDAIERAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEETE
LYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K9X2	0.997	0.997	4.114E-51	412	0.966	0.966	A0A0G2K9X2.pdb.gz	A0A0G2K9X2_RAT Receptor-associated protein of the synapse OS=Rattus norvegicus OX=10116 GN=Rapsn PE=3 SV=1
2	AFDB:Q8QGW4	0.984	0.984	6.412E-42	412	0.748	0.748	Q8QGW4.pdb.gz	Q8QGW4_DANRE 43 kDa receptor-associated protein of the synapse OS=Danio rerio OX=7955 GN=rapsyn PE=2 SV=1
3	AFDB:D3ZPG2	0.426	0.489	3.781E-35	359	0.840	0.964	D3ZPG2.pdb.gz	D3ZPG2_RAT Receptor-associated protein of the synapse OS=Rattus norvegicus OX=10116 GN=Rapsn PE=3 SV=1
4	AFDB:Q09485	0.938	0.654	5.892E-24	596	0.316	0.218	Q09485.pdb.gz	RAPSN_CAEEL 43 kDa receptor-associated protein of the synapse homolog OS=Caenorhabditis elegans OX=6239 GN=rpy-1 PE=1 SV=1
5	AFDB:Q96AY4	0.515	0.117	2.873E-10	2481	0.153	0.025	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
6	AFDB:A0A024R0F8	0.470	0.306	1.208E-9	684	0.153	0.092	A0A024R0F8.pdb.gz
7	AFDB:Q9NFR7	0.457	0.307	2.183E-9	658	0.148	0.093	Q9NFR7.pdb.gz	Q9NFR7_DROME Rapsynoid OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
8	AFDB:A0A0A0MRC4	0.483	0.304	6.830E-9	707	0.136	0.079	A0A0A0MRC4.pdb.gz	A0A0A0MRC4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
9	AFDB:Q38CX9	0.560	0.198	3.548E-8	1378	0.160	0.048	Q38CX9.pdb.gz	Q38CX9_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2660 PE=4 SV=1
10	AFDB:Q19955	0.318	0.235	6.976E-8	579	0.148	0.105	Q19955.pdb.gz	Q19955_CAEEL Tetratricopeptide repeat protein 28 OS=Caenorhabditis elegans OX=6239 GN=ags-3 PE=1 SV=1
11	PDB:4gyoB	0.605	0.680	8.050E-7	359	0.109	0.125	4gyoB.pdb.gz	Conformational change-induced repeat domain expansion regulates rap phosphatase quorum-sensing signal receptors.
12	PDB:5dseA	0.528	0.423	8.577E-6	537	0.141	0.108	5dseA.pdb.gz
13	PDB:7ntfA	0.361	0.194	8.947E-6	918	0.136	0.061	7ntfA.pdb.gz
14	PDB:7qe7J	0.492	0.413	9.333E-6	510	0.133	0.108	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:8a3tJ	0.343	0.284	1.153E-5	509	0.138	0.112	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:3q15A	0.469	0.514	1.203E-5	365	0.138	0.156	3q15A.pdb.gz	Structural basis of response regulator dephosphorylation by Rap phosphatases.
17	PDB:4i9eA	0.422	0.445	1.686E-5	383	0.117	0.125	4i9eA.pdb.gz	Structural basis of Rap phosphatase inhibition by Phr peptides
18	PDB:7dhgC	0.317	0.283	2.266E-5	470	0.117	0.102	7dhgC.pdb.gz
19	PDB:8a3tD	0.408	0.316	3.046E-5	560	0.121	0.089	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:6bq1B	0.517	0.322	3.925E-5	728	0.138	0.078	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K9X2	0.0	824	412	0.966	0.966	A0A0G2K9X2_RAT Receptor-associated protein of the synapse OS=Rattus norvegicus OX=10116 GN=Rapsn PE=3 SV=1
2	A0A0S2Z4F8	0.0	850	412	1.000	1.000	A0A0S2Z4F8_HUMAN Receptor-associated protein of the synapse isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=RAPSN PE=2 SV=1
3	A0A8I6AIQ1	0.0	625	353	0.784	0.915	A0A8I6AIQ1_RAT Receptor-associated protein of the synapse OS=Rattus norvegicus OX=10116 GN=Rapsn PE=3 SV=1
4	D3ZPG2	0.0	629	359	0.789	0.905	D3ZPG2_RAT Receptor-associated protein of the synapse OS=Rattus norvegicus OX=10116 GN=Rapsn PE=3 SV=1
5	E9PJP9	0.0	650	359	0.816	0.936	E9PJP9_HUMAN Receptor associated protein of the synapse OS=Homo sapiens OX=9606 GN=RAPSN PE=1 SV=2
6	P12672	0.0	822	412	0.961	0.961	RAPSN_MOUSE 43 kDa receptor-associated protein of the synapse OS=Mus musculus OX=10090 GN=Rapsn PE=2 SV=4
7	Q13702	0.0	850	412	1.000	1.000	RAPSN_HUMAN 43 kDa receptor-associated protein of the synapse OS=Homo sapiens OX=9606 GN=RAPSN PE=1 SV=4
8	Q8QGW4	0.0	652	412	0.748	0.748	Q8QGW4_DANRE 43 kDa receptor-associated protein of the synapse OS=Danio rerio OX=7955 GN=rapsyn PE=2 SV=1
9	Q09485	2.36e-62	213	596	0.328	0.227	RAPSN_CAEEL 43 kDa receptor-associated protein of the synapse homolog OS=Caenorhabditis elegans OX=6239 GN=rpy-1 PE=1 SV=1
10	F6QN66	3.93e-12	70.9	2481	0.231	0.038	F6QN66_MACMU Tetratricopeptide repeat domain 28 OS=Macaca mulatta OX=9544 GN=TTC28 PE=4 SV=1
11	Q96AY4	4.44e-12	70.5	2481	0.231	0.038	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
12	A0A0A0MRC4	8.00e-07	53.5	707	0.136	0.079	A0A0A0MRC4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
13	A0A0A0MSK4	9.27e-07	53.5	675	0.133	0.081	A0A0A0MSK4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=1
14	Q86YR5	9.60e-07	53.5	675	0.133	0.081	GPSM1_HUMAN G-protein-signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
15	H0Y4A4	1.05e-06	53.1	627	0.102	0.067	H0Y4A4_HUMAN G protein signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=2
16	P81274	1.06e-06	53.1	684	0.102	0.061	GPSM2_HUMAN G-protein-signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=3
17	Q8VDU0	1.45e-06	52.8	679	0.114	0.069	GPSM2_MOUSE G-protein-signaling modulator 2 OS=Mus musculus OX=10090 GN=Gpsm2 PE=1 SV=2
18	Q9R080	2.12e-06	52.4	673	0.131	0.080	GPSM1_RAT G-protein-signaling modulator 1 OS=Rattus norvegicus OX=10116 GN=Gpsm1 PE=1 SV=2
19	Q9NH88	2.28e-06	52.0	658	0.104	0.065	Q9NH88_DROME Partner of Inscuteable OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
20	Q9VB22	2.28e-06	52.0	658	0.104	0.065	Q9VB22_DROME LD33695p OS=Drosophila melanogaster OX=7227 GN=pins PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	1.5e+02	14.0	Anaphase-promoting complex, cyclosome, subunit 3
2	PF12862 ANAPC5	3.4e+02	12.7	Anaphase-promoting complex subunit 5
3	PF12968 DUF3856	6.5	18.2	Domain of Unknown Function (DUF3856)
4	PF14447 Prok-RING_4	5.9	18.2	Prokaryotic RING finger family 4
5	PF10579 Rapsyn_N	1.5e-32	122.8	Rapsyn N-terminal myristoylation and linker region
6	PF14938 SNAP	6.7	17.7	Soluble NSF attachment protein, SNAP
7	PF00515 TPR_1	5e-12	56.3	Tetratricopeptide repeat
8	PF13374 TPR_10	1.3	20.2	Tetratricopeptide repeat
9	PF13414 TPR_11	0.0075	27.2	TPR repeat
10	PF13424 TPR_12	4.6e-14	63.8	Tetratricopeptide repeat
11	PF13428 TPR_14	1.5	20.8	Tetratricopeptide repeat
12	PF13432 TPR_16	3.3	19.7	Tetratricopeptide repeat
13	PF14559 TPR_19	0.076	24.8	Tetratricopeptide repeat
14	PF07719 TPR_2	4.6e-09	46.7	Tetratricopeptide repeat
15	PF13174 TPR_6	2e+02	14.1	Tetratricopeptide repeat
16	PF13176 TPR_7	7.7e-07	39.8	Tetratricopeptide repeat
17	PF13181 TPR_8	3.9e-07	40.8	Tetratricopeptide repeat
18	PF17874 TPR_MalT	7.7e-07	40.4	MalT-like TPR region
19	PF00097 zf-C3HC4	46	15.3	Zinc finger, C3HC4 type (RING finger)
20	PF12678 zf-rbx1	49	15.6	RING-H2 zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298854

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363571	0.999	Muscle, skeletal receptor tyrosine-protein kinase
2	9606.ENSP00000442600	0.994	Dystroglycan
3	9606.ENSP00000304290	0.990	Acetylcholine receptor subunit beta
4	9606.ENSP00000368678	0.990	Agrin
5	9606.ENSP00000356515	0.984	Utrophin
6	9606.ENSP00000261007	0.979	Acetylcholine receptor subunit alpha
7	9606.ENSP00000374145	0.971	Acetylcholine receptor subunit gamma
8	9606.ENSP00000354923	0.951	Dystrophin
9	9606.ENSP00000354573	0.939	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
10	9606.ENSP00000362680	0.929	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000388325	0.926	Laminin subunit beta-2
12	9606.ENSP00000355645	0.922	Actin, alpha skeletal muscle
13	9606.ENSP00000365745	0.922	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
14	9606.ENSP00000400365	0.918	Laminin subunit alpha-2
15	9606.ENSP00000344432	0.913	Protein Dok-7
16	9606.ENSP00000222399	0.909	Laminin subunit beta-1
17	9606.ENSP00000252999	0.909	Laminin subunit alpha-5
18	9606.ENSP00000278568	0.905	Serine/threonine-protein kinase PAK 1
19	9606.ENSP00000380638	0.905	Protein-tyrosine kinase 2-beta
20	9606.ENSP00000306490	0.904	Muscarinic acetylcholine receptor M1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0035255	0.935	ionotropic glutamate receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:1990778	0.985	protein localization to cell periphery
GO:0051668	0.964	localization within membrane
GO:0048518	0.935	positive regulation of biological process
GO:1902414	0.917	protein localization to cell junction
GO:0048522	0.916	positive regulation of cellular process
GO:0062237	0.902	protein localization to postsynapse
GO:1903539	0.886	protein localization to postsynaptic membrane
GO:0007267	0.797	cell-cell signaling
GO:0023051	0.751	regulation of signaling
GO:0010646	0.750	regulation of cell communication
GO:0051128	0.710	regulation of cellular component organization
GO:0051234	0.624	establishment of localization
GO:0099536	0.574	synaptic signaling
GO:0090150	0.573	establishment of protein localization to membrane
GO:0007271	0.523	synaptic transmission, cholinergic
GO:1900073	0.494	regulation of neuromuscular synaptic transmission
GO:0050806	0.483	positive regulation of synaptic transmission
GO:0050896	0.474	response to stimulus
GO:0032501	0.443	multicellular organismal process
GO:0048856	0.416	anatomical structure development
GO:0071840	0.365	cellular component organization or biogenesis
GO:0016043	0.355	cellular component organization
GO:0051716	0.354	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0005886	0.997	plasma membrane
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005829	0.986	cytosol
GO:0005856	0.916	cytoskeleton
GO:0030054	0.807	cell junction
GO:0005815	0.728	microtubule organizing center
GO:0045202	0.709	synapse
GO:0043231	0.706	intracellular membrane-bounded organelle
GO:0005813	0.677	centrosome
GO:0031594	0.515	neuromuscular junction
GO:0012505	0.416	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]