StarFunc result for job id Q13705

User Input

>input (512 residues)
MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P27040	0.635	0.607	5.569E-99	536	0.990	0.946	P27040.pdb.gz	AVR2B_MOUSE Activin receptor type-2B OS=Mus musculus OX=10090 GN=Acvr2b PE=1 SV=1
2	AFDB:P38445	0.620	0.619	9.622E-96	513	0.990	0.988	P38445.pdb.gz	AVR2B_RAT Activin receptor type-2B OS=Rattus norvegicus OX=10116 GN=Acvr2b PE=1 SV=3
3	AFDB:F1NCI7	0.656	0.656	4.356E-94	512	0.893	0.893	F1NCI7.pdb.gz
4	AFDB:F1QLL7	0.665	0.668	8.316E-84	509	0.746	0.750	F1QLL7.pdb.gz
5	AFDB:A9CAY0	0.728	0.726	1.617E-78	514	0.650	0.648	A9CAY0.pdb.gz
6	AFDB:P27037	0.680	0.679	1.617E-78	513	0.668	0.667	P27037.pdb.gz	AVR2A_HUMAN Activin receptor type-2A OS=Homo sapiens OX=9606 GN=ACVR2A PE=1 SV=1
7	AFDB:F1R4D0	0.614	0.585	7.318E-77	538	0.668	0.636	F1R4D0.pdb.gz
8	AFDB:Q24229	0.584	0.580	1.262E-60	516	0.455	0.452	Q24229.pdb.gz	Q24229_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=2 SV=1
9	AFDB:O35607	0.560	0.280	2.103E-47	1038	0.354	0.174	O35607.pdb.gz	BMPR2_MOUSE Bone morphogenetic protein receptor type-2 OS=Mus musculus OX=10090 GN=Bmpr2 PE=1 SV=1
10	AFDB:O42124	0.570	0.289	7.355E-47	1031	0.330	0.164	O42124.pdb.gz	O42124_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BRK-3 PE=2 SV=1
11	PDB:8dksA	0.397	0.696	4.896E-18	283	0.145	0.261	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:4krcA	0.426	0.712	4.916E-16	297	0.137	0.236	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
13	PDB:2qkwB	0.403	0.682	7.751E-16	292	0.139	0.243	2qkwB.pdb.gz
14	PDB:5u6yA	0.430	0.476	1.927E-15	459	0.117	0.131	5u6yA.pdb.gz
15	PDB:1k9aB	0.417	0.481	3.215E-15	441	0.141	0.163	1k9aB.pdb.gz
16	PDB:6lk5A	0.406	0.752	3.814E-15	265	0.117	0.226	6lk5A.pdb.gz
17	PDB:4rerA	0.410	0.454	5.366E-15	459	0.125	0.139	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:3c4wB	0.431	0.426	6.364E-15	519	0.133	0.131	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
19	PDB:4zhxA	0.412	0.507	1.003E-14	409	0.121	0.152	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:5ufuA	0.418	0.563	1.003E-14	369	0.119	0.165	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QG01	0.0	717	514	0.668	0.665	F1QG01_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=actr2a PE=3 SV=1
2	P27037	0.0	693	513	0.672	0.671	AVR2A_HUMAN Activin receptor type-2A OS=Homo sapiens OX=9606 GN=ACVR2A PE=1 SV=1
3	P27038	0.0	692	513	0.670	0.669	AVR2A_MOUSE Activin receptor type-2A OS=Mus musculus OX=10090 GN=Acvr2a PE=1 SV=1
4	P27040	0.0	1040	536	0.994	0.950	AVR2B_MOUSE Activin receptor type-2B OS=Mus musculus OX=10090 GN=Acvr2b PE=1 SV=1
5	P38444	0.0	689	513	0.666	0.665	AVR2A_RAT Activin receptor type-2A OS=Rattus norvegicus OX=10116 GN=Acvr2a PE=1 SV=1
6	P38445	0.0	1046	513	0.990	0.988	AVR2B_RAT Activin receptor type-2B OS=Rattus norvegicus OX=10116 GN=Acvr2b PE=1 SV=3
7	Q13705	0.0	1063	512	1.000	1.000	AVR2B_HUMAN Activin receptor type-2B OS=Homo sapiens OX=9606 GN=ACVR2B PE=1 SV=3
8	Q66T47	0.0	1056	512	0.992	0.992	AVR2B_PIG Activin receptor type-2B OS=Sus scrofa OX=9823 GN=ACVR2B PE=2 SV=1
9	Q90669	0.0	720	513	0.680	0.678	AVR2A_CHICK Activin receptor type-2A OS=Gallus gallus OX=9031 GN=ACVR2A PE=2 SV=1
10	Q90670	0.0	957	512	0.895	0.895	AVR2B_CHICK Activin receptor type-2B OS=Gallus gallus OX=9031 GN=ACVR2B PE=2 SV=1
11	Q9YGU4	0.0	842	509	0.773	0.778	Q9YGU4_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=ActrIIB PE=1 SV=1
12	Q24468	2.62e-150	441	516	0.465	0.461	Q24468_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=1 SV=1
13	Q24229	3.51e-150	441	516	0.459	0.455	Q24229_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=2 SV=1
14	A0A0B4KG59	3.67e-150	441	520	0.465	0.458	A0A0B4KG59_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=1 SV=1
15	Q95T01	1.08e-115	344	284	0.340	0.613	Q95T01_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=2 SV=1
16	Q90999	1.89e-90	289	557	0.342	0.314	TGFR2_CHICK TGF-beta receptor type-2 OS=Gallus gallus OX=9031 GN=TGFBR2 PE=1 SV=1
17	Q62312	2.04e-90	289	567	0.344	0.310	TGFR2_MOUSE TGF-beta receptor type-2 OS=Mus musculus OX=10090 GN=Tgfbr2 PE=1 SV=2
18	P38438	8.06e-90	288	567	0.352	0.317	TGFR2_RAT TGF-beta receptor type-2 OS=Rattus norvegicus OX=10116 GN=Tgfbr2 PE=1 SV=1
19	Q13873	1.51e-88	295	1038	0.348	0.171	BMPR2_HUMAN Bone morphogenetic protein receptor type-2 OS=Homo sapiens OX=9606 GN=BMPR2 PE=1 SV=2
20	P37173	2.51e-88	283	567	0.346	0.312	TGFR2_HUMAN TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01064 Activin_recp	1e-06	40.9	Activin types I and II receptor domain
2	PF00069 Pkinase	3.3e-27	107.1	Protein kinase domain
3	PF17667 Pkinase_fungal	1.7	19.0	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	4.6e-22	90.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257868	0.999	Growth/differentiation factor 11
2	9606.ENSP00000260950	0.999	Growth/differentiation factor 8
3	9606.ENSP00000368104	0.999	Bone morphogenetic protein 2
4	9606.ENSP00000463051	0.998	Growth/differentiation factor 2
5	9606.ENSP00000242208	0.997	Inhibin beta A chain
6	9606.ENSP00000379204	0.993	Bone morphogenetic protein 7
7	9606.ENSP00000262160	0.987	Mothers against decapentaplegic homolog 2
8	9606.ENSP00000282701	0.982	Bone morphogenetic protein 3
9	9606.ENSP00000361107	0.979	Bone morphogenetic protein receptor type-1A
10	9606.ENSP00000364133	0.978	TGF-beta receptor type-1
11	9606.ENSP00000373574	0.975	Serine/threonine-protein kinase receptor R3
12	9606.ENSP00000332973	0.974	Mothers against decapentaplegic homolog 3
13	9606.ENSP00000441954	0.974	Mothers against decapentaplegic homolog 5
14	9606.ENSP00000369154	0.971	Mothers against decapentaplegic homolog 9
15	9606.ENSP00000245451	0.966	Bone morphogenetic protein 4
16	9606.ENSP00000283147	0.965	Bone morphogenetic protein 6
17	9606.ENSP00000296145	0.963	Teratocarcinoma-derived growth factor 1
18	9606.ENSP00000287139	0.961	Nodal homolog
19	9606.ENSP00000341551	0.961	Mothers against decapentaplegic homolog 4
20	9606.ENSP00000426568	0.960	Mothers against decapentaplegic homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0048185	1.000	activin binding
GO:0004675	0.997	transmembrane receptor protein serine/threonine kinase activity
GO:0019838	0.490	growth factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.990	regulation of metabolic process
GO:0050896	0.988	response to stimulus
GO:0032502	0.988	developmental process
GO:0009987	0.988	cellular process
GO:0023051	0.988	regulation of signaling
GO:0010646	0.988	regulation of cell communication
GO:0032501	0.987	multicellular organismal process
GO:0051239	0.986	regulation of multicellular organismal process
GO:0048856	0.983	anatomical structure development
GO:0010468	0.983	regulation of gene expression
GO:0007167	0.976	enzyme-linked receptor protein signaling pathway
GO:0048523	0.975	negative regulation of cellular process
GO:0007178	0.973	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048513	0.961	animal organ development
GO:0048518	0.959	positive regulation of biological process
GO:0032924	0.958	activin receptor signaling pathway
GO:0048869	0.957	cellular developmental process
GO:0048583	0.953	regulation of response to stimulus
GO:0009888	0.950	tissue development
GO:0031326	0.933	regulation of cellular biosynthetic process
GO:0019219	0.932	regulation of nucleobase-containing compound metabolic process
GO:0007275	0.924	multicellular organism development
GO:0051252	0.924	regulation of RNA metabolic process
GO:0048731	0.894	system development
GO:0030154	0.882	cell differentiation
GO:0009892	0.881	negative regulation of metabolic process
GO:0001817	0.867	regulation of cytokine production
GO:0010605	0.866	negative regulation of macromolecule metabolic process
GO:0008152	0.854	metabolic process
GO:0009967	0.853	positive regulation of signal transduction
GO:0010556	0.834	regulation of macromolecule biosynthetic process
GO:0051241	0.830	negative regulation of multicellular organismal process
GO:0001501	0.829	skeletal system development
GO:0071704	0.819	organic substance metabolic process
GO:0071634	0.816	regulation of transforming growth factor beta production
GO:0044238	0.815	primary metabolic process
GO:1903506	0.809	regulation of nucleic acid-templated transcription
GO:0044237	0.805	cellular metabolic process
GO:0010604	0.805	positive regulation of macromolecule metabolic process
GO:0006807	0.804	nitrogen compound metabolic process
GO:0090092	0.799	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051173	0.787	positive regulation of nitrogen compound metabolic process
GO:0006355	0.776	regulation of DNA-templated transcription
GO:0070848	0.772	response to growth factor
GO:1901564	0.772	organonitrogen compound metabolic process
GO:0050793	0.754	regulation of developmental process
GO:0016310	0.740	phosphorylation
GO:0001818	0.739	negative regulation of cytokine production
GO:0043170	0.730	macromolecule metabolic process
GO:0023057	0.724	negative regulation of signaling
GO:0051240	0.719	positive regulation of multicellular organismal process
GO:0051094	0.719	positive regulation of developmental process
GO:0010648	0.718	negative regulation of cell communication
GO:0035270	0.715	endocrine system development
GO:2000026	0.701	regulation of multicellular organismal development
GO:0019538	0.695	protein metabolic process
GO:0071495	0.662	cellular response to endogenous stimulus
GO:0031325	0.658	positive regulation of cellular metabolic process
GO:0030325	0.644	adrenal gland development
GO:0071363	0.624	cellular response to growth factor stimulus
GO:0043412	0.623	macromolecule modification
GO:0036211	0.573	protein modification process
GO:0045595	0.536	regulation of cell differentiation
GO:0051246	0.518	regulation of protein metabolic process
GO:0006468	0.462	protein phosphorylation
GO:0009653	0.457	anatomical structure morphogenesis
GO:0006357	0.451	regulation of transcription by RNA polymerase II
GO:0051247	0.426	positive regulation of protein metabolic process
GO:0045935	0.409	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.407	positive regulation of biosynthetic process
GO:0051254	0.404	positive regulation of RNA metabolic process
GO:0007399	0.403	nervous system development
GO:1902680	0.359	positive regulation of RNA biosynthetic process
GO:0051174	0.356	regulation of phosphorus metabolic process
GO:0045893	0.351	positive regulation of DNA-templated transcription
GO:0019220	0.341	regulation of phosphate metabolic process
GO:0071773	0.335	cellular response to BMP stimulus
GO:0030509	0.333	BMP signaling pathway
GO:0001932	0.316	regulation of protein phosphorylation
GO:0048585	0.309	negative regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0071944	0.996	cell periphery
GO:0005886	0.993	plasma membrane
GO:0005622	0.963	intracellular anatomical structure
GO:0032991	0.956	protein-containing complex
GO:0005737	0.860	cytoplasm
GO:0043226	0.453	organelle
GO:0098796	0.399	membrane protein complex
GO:0043235	0.397	receptor complex
GO:0043229	0.397	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.997	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.997	receptor protein serine/threonine kinase.

[back to server]