StarFunc result for job id Q13733

User Input

>input (1029 residues)
MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELS
TKYSVDLTKGHSHQRAKEILTRGGPNTVTPPPTTPEWVKFCKQLFGGFSLLLWTGAILCF
VAYSIQIYFNEEPTKDNLYLSIVLSVVVIVTGCFSYYQEAKSSKIMESFKNMVPQQALVI
RGGEKMQINVQEVVLGDLVEIKGGDRVPADLRLISAQGCKVDNSSLTGESEPQSRSPDFT
HENPLETRNICFFSTNCVEGTARGIVIATGDSTVMGRIASLTSGLAVGQTPIAAEIEHFI
HLITVVAVFLGVTFFALSLLLGYGWLEAIIFLIGIIVANVPEGLLATVTVCLTLTAKRMA
RKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDMTVYEADTTEEQTGKTFT
KSSDTWFMLARIAGLCNRADFKANQEILPIAKRATTGDASESALLKFIEQSYSSVAEMRE
KNPKVAEIPFNSTNKYQMSIHLREDSSQTHVLMMKGAPERILEFCSTFLLNGQEYSMNDE
MKEAFQNAYLELGGLGERVLGFCFLNLPSSFSKGFPFNTDEINFPMDNLCFVGLISMIDP
PRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETAEEVAARLKIPISK
VDASAAKAIVVHGAELKDIQSKQLDQILQNHPEIVFARTSPQQKLIIVEGCQRLGAVVAV
TGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKK
SIMYTLTSNIPEITPFLMFIILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKR
LPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKY
LNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVVVQWADLIISKTRRNSLFQQGMRNKVL
IFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCAIPYSILIFVYDEIRKLLIRQHPD
GWVERETYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3b8eA	0.931	0.959	0.000	998	0.765	0.789	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
2	PDB:8d3xA	0.940	0.978	0.000	989	0.761	0.792	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
3	AFDB:A2VDL6	0.976	0.984	0.000	1020	0.785	0.792	A2VDL6.pdb.gz	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
4	AFDB:A8QI34	0.961	0.980	0.000	1009	0.596	0.608	A8QI34.pdb.gz	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
5	AFDB:B0S5Q5	0.974	0.986	0.000	1017	0.768	0.777	B0S5Q5.pdb.gz
6	AFDB:B8JKS9	0.976	0.982	0.000	1023	0.716	0.720	B8JKS9.pdb.gz
7	AFDB:C0H8U1	0.963	0.964	0.000	1028	0.758	0.759	C0H8U1.pdb.gz	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
8	AFDB:E1B8N5	0.965	0.964	0.000	1030	0.865	0.864	E1B8N5.pdb.gz	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
9	AFDB:P13607	0.957	0.946	0.000	1041	0.704	0.695	P13607.pdb.gz	ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3
10	AFDB:P20648	0.962	0.956	0.000	1035	0.592	0.588	P20648.pdb.gz	ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens OX=9606 GN=ATP4A PE=1 SV=5
11	AFDB:P54707	0.973	0.964	0.000	1039	0.614	0.608	P54707.pdb.gz	AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens OX=9606 GN=ATP12A PE=1 SV=3
12	AFDB:P54708	0.966	0.959	0.000	1036	0.616	0.612	P54708.pdb.gz	AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus OX=10116 GN=Atp12a PE=1 SV=1
13	PDB:7x20A	0.931	0.971	1.085E-102	986	0.605	0.632	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
14	PDB:3ixzA	0.922	0.949	5.553E-95	998	0.583	0.601	3ixzA.pdb.gz
15	PDB:7e7sA	0.587	0.591	1.575E-56	1020	0.280	0.282	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
16	PDB:5zmwA	0.564	0.579	2.421E-54	1000	0.278	0.286	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
17	PDB:6a69A	0.547	0.604	8.178E-40	911	0.229	0.259	6a69A.pdb.gz
18	PDB:7vpkA	0.688	0.672	1.160E-34	1055	0.180	0.175	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
19	PDB:7vh5A	0.489	0.604	4.354E-34	804	0.193	0.248	7vh5A.pdb.gz
20	PDB:7rd6A	0.565	0.616	2.508E-32	929	0.169	0.187	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060D574	1425	875	0.672	0.790	A0A060D574_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1c PE=2 SV=1
2	A0A060D9G1	1367	876	0.636	0.747	A0A060D9G1_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1a PE=2 SV=1
3	A0A060XA63	870	517	0.397	0.791	A0A060XA63_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000245001 PE=3 SV=1
4	A0A060YJC3	1617	992	0.754	0.782	A0A060YJC3_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025817001 PE=3 SV=1
5	A0A060YK73	881	534	0.403	0.777	A0A060YK73_ONCMY Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025818001 PE=3 SV=1
6	A0A075Q735	924	639	0.452	0.728	A0A075Q735_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
7	A0A075QE41	957	661	0.467	0.728	A0A075QE41_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
8	A2VDL6	1697	1020	0.779	0.786	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
9	A8QI34	1273	1009	0.601	0.612	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
10	C0H8U1	1575	1028	0.747	0.748	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
11	C0PUF8	889	524	0.408	0.802	C0PUF8_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
12	E1B8N5	1843	1030	0.866	0.865	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
13	F1MR06	1566	988	0.740	0.770	F1MR06_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A3 PE=3 SV=3
14	P05023	1668	1023	0.772	0.776	AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1
15	P05024	1660	1021	0.769	0.775	AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa OX=9823 GN=ATP1A1 PE=1 SV=1
16	P06685	1652	1023	0.770	0.774	AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Atp1a1 PE=1 SV=1
17	P06686	1692	1020	0.780	0.787	AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Atp1a2 PE=1 SV=1
18	P06687	1652	1013	0.763	0.775	AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Atp1a3 PE=1 SV=2
19	P09572	1618	1021	0.762	0.768	AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus OX=9031 GN=ATP1A1 PE=2 SV=1
20	P09626	1283	1033	0.586	0.584	ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus OX=10116 GN=Atp4a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	4.6e-19	79.6	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	1.9e-41	153.3	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	5.6e-09	46.9	Cation transporter/ATPase, N-terminus
4	PF11491 DUF3213	2.3e+02	13.4	Protein of unknown function (DUF3213)
5	PF00122 E1-E2_ATPase	2.3e-41	152.8	E1-E2 ATPase
6	PF12710 HAD	61	15.5	haloacid dehalogenase-like hydrolase
7	PF00702 Hydrolase	4.8e-15	68.0	haloacid dehalogenase-like hydrolase
8	PF08282 Hydrolase_3	0.038	25.3	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357060

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356790	0.979	Sodium/potassium-transporting ATPase subunit beta-1
2	9606.ENSP00000292079	0.972	Sodium/potassium-transporting ATPase subunit gamma
3	9606.ENSP00000218008	0.952	Protein ATP1B4
4	9606.ENSP00000250111	0.949	Sodium/potassium-transporting ATPase subunit beta-2
5	9606.ENSP00000286371	0.948	Sodium/potassium-transporting ATPase subunit beta-3
6	9606.ENSP00000481244	0.845	Phospholemman
7	9606.ENSP00000433295	0.808	G protein-activated inward rectifier potassium channel 4
8	9606.ENSP00000354490	0.804	Sodium/potassium-transporting ATPase subunit alpha-2
9	9606.ENSP00000444688	0.804	Sodium/potassium-transporting ATPase subunit alpha-3
10	9606.ENSP00000445306	0.802	Sodium/potassium-transporting ATPase subunit alpha-1
11	9606.ENSP00000288139	0.779	Voltage-dependent L-type calcium channel subunit alpha-1D
12	9606.ENSP00000309052	0.726	Cation channel sperm-associated protein 1
13	9606.ENSP00000334216	0.726	Potassium-transporting ATPase subunit beta
14	9606.ENSP00000362680	0.718	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000371180	0.713	Cation channel sperm-associated protein 2
16	9606.ENSP00000339191	0.701	Caveolin-1
17	9606.ENSP00000325822	0.685	Cytochrome P450 11B2, mitochondrial
18	9606.ENSP00000263980	0.676	Sodium/hydrogen exchanger 1
19	9606.ENSP00000369320	0.673	Retinoschisin
20	9606.ENSP00000309591	0.669	cAMP-dependent protein kinase catalytic subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005391	1.000	P-type sodium:potassium-exchanging transporter activity
GO:0005515	0.996	protein binding
GO:0097159	0.490	organic cyclic compound binding
GO:1901363	0.399	heterocyclic compound binding
GO:0043167	0.378	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051179	0.986	localization
GO:0009987	0.982	cellular process
GO:0065007	0.968	biological regulation
GO:0006810	0.968	transport
GO:0006812	0.917	monoatomic cation transport
GO:0050789	0.895	regulation of biological process
GO:0006814	0.884	sodium ion transport
GO:0007018	0.817	microtubule-based movement
GO:0006813	0.816	potassium ion transport
GO:0055085	0.788	transmembrane transport
GO:0055080	0.782	monoatomic cation homeostasis
GO:0006885	0.753	regulation of pH
GO:0000003	0.746	reproduction
GO:0032501	0.723	multicellular organismal process
GO:0097722	0.720	sperm motility
GO:0003341	0.688	cilium movement
GO:0001539	0.687	cilium or flagellum-dependent cell motility
GO:0030317	0.668	flagellated sperm motility
GO:0050896	0.588	response to stimulus
GO:0050794	0.538	regulation of cellular process
GO:0065008	0.472	regulation of biological quality
GO:0098660	0.438	inorganic ion transmembrane transport
GO:0034220	0.427	monoatomic ion transmembrane transport
GO:0098662	0.418	inorganic cation transmembrane transport
GO:0006873	0.404	intracellular monoatomic ion homeostasis
GO:0098655	0.383	monoatomic cation transmembrane transport
GO:0030003	0.374	intracellular monoatomic cation homeostasis
GO:0032502	0.366	developmental process
GO:0051716	0.329	cellular response to stimulus
GO:0051239	0.311	regulation of multicellular organismal process
GO:0042221	0.303	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.954	organelle
GO:0032991	0.951	protein-containing complex
GO:0043227	0.942	membrane-bounded organelle
GO:1902495	0.937	transmembrane transporter complex
GO:0005622	0.831	intracellular anatomical structure
GO:0098533	0.771	ATPase dependent transmembrane transport complex
GO:0098797	0.769	plasma membrane protein complex
GO:0090533	0.699	cation-transporting ATPase complex
GO:0098590	0.558	plasma membrane region
GO:0043231	0.547	intracellular membrane-bounded organelle
GO:0005737	0.487	cytoplasm
GO:0012505	0.455	endomembrane system
GO:0031090	0.368	organelle membrane
GO:0098857	0.364	membrane microdomain
GO:0005576	0.349	extracellular region
GO:0031982	0.344	vesicle
GO:1903561	0.329	extracellular vesicle
GO:0005890	0.318	sodium:potassium-exchanging ATPase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18353	1.000	ATP + H2O + K(+)(out) + Na(+)(in) = ADP + H(+) + K(+)(in) + Na(+)(out) + phosphate
EC:7.2.2.13	1.000	Na(+)/K(+)-exchanging ATPase.

[back to server]