StarFunc result for job id Q13753

User Input

>input (1193 residues)
MPALWLGCCLCFSLLLPAARATSRREVCDCNGKSRQCIFDRELHRQTGNGFRCLNCNDNT
DGIHCEKCKNGFYRHRERDRCLPCNCNSKGSLSARCDNSGRCSCKPGVTGARCDRCLPGF
HMLTDAGCTQDQRLLDSKCDCDPAGIAGPCDAGRCVCKPAVTGERCDRCRSGYYNLDGGN
PEGCTQCFCYGHSASCRSSAEYSVHKITSTFHQDVDGWKAVQRNGSPAKLQWSQRHQDVF
SSAQRLDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRHPSAHDVILEGAGLRITAPL
MPLGKTLPCGLTKTYTFRLNEHPSNNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYI
DNVTLISARPVSGAPAPWVEQCICPVGYKGQFCQDCASGYKRDSARLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSDGTCVCKPGFGGP
NCEHGAFSCPACYNQVKIQMDQFMQQLQRMEALISKAQGGDGVVPDTELEGRMQQAEQAL
QDILRDAQISEGASRSLGLQLAKVRSQENSYQSRLDDLKMTVERVRALGSQYQNRVRDTH
RLITQMQLSLAESEASLGNTNIPASDHYVGPNGFKSLAQEATRLAESHVESASNMEQLTR
ETEDYSKQALSLVRKALHEGVGSGSGSPDGAVVQGLVEKLEKTKSLAQQLTREATQAEIE
ADRSYQHSLRLLDSVSRLQGVSDQSFQVEEAKRIKQKADSLSSLVTRHMDEFKRTQKNLG
NWKEEAQQLLQNGKSGREKSDQLLSRANLAKSRAQEALSMGNATFYEVESILKNLREFDL
QVDNRKAEAEEAMKRLSYISQKVSDASDKTQQAERALGSAAADAQRAKNGAGEALEISSE
IEQEIGSLNLEANVTADGALAMEKGLASLKSEMREVEGELERKELEFDTNMDAVQMVITE
AQKVDTRAKNAGVTIQDTLNTLDGLLHLMDQPLSVDEEGLVLLEQKLSRAKTQINSQLRP
MMSELEERARQQRGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LRH4	0.448	0.448	0.000	1192	0.847	0.848	F1LRH4.pdb.gz	F1LRH4_RAT Laminin subunit gamma 2 OS=Rattus norvegicus OX=10116 GN=Lamc2 PE=4 SV=1
2	AFDB:Q13753	1.000	1.000	0.000	1193	1.000	1.000	Q13753.pdb.gz	LAMC2_HUMAN Laminin subunit gamma-2 OS=Homo sapiens OX=9606 GN=LAMC2 PE=1 SV=2
3	AFDB:P11047	0.273	0.209	1.808E-97	1609	0.422	0.313	P11047.pdb.gz	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
4	AFDB:Q1LVF0	0.277	0.216	5.054E-96	1593	0.402	0.301	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
5	AFDB:Q9Y6N6	0.221	0.170	1.643E-69	1575	0.324	0.245	Q9Y6N6.pdb.gz	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
6	AFDB:Q9R0B6	0.218	0.167	6.733E-68	1581	0.315	0.238	Q9R0B6.pdb.gz	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
7	AFDB:Q18823	0.250	0.188	1.032E-66	1633	0.276	0.201	Q18823.pdb.gz	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
8	AFDB:F1QPJ1	0.260	0.196	9.949E-63	1643	0.308	0.224	F1QPJ1.pdb.gz	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
9	AFDB:D3ZQN7	0.087	0.064	1.942E-34	1786	0.252	0.169	D3ZQN7.pdb.gz	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
10	AFDB:B7ZDA6	0.095	0.066	2.288E-34	1782	0.256	0.171	B7ZDA6.pdb.gz	B7ZDA6_DANRE Laminin subunit beta-2 precursor OS=Danio rerio OX=7955 GN=si:dkey-32e6.2 PE=1 SV=1
11	PDB:3ipvA	0.088	0.304	1.679E-2	249	0.019	0.092	3ipvA.pdb.gz	X-ray structure of a galactose-specific lectin from Spatholobous parviflorous
12	PDB:5e7gA	0.089	0.195	2.461E-2	446	0.021	0.056	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
13	PDB:2vvfA	0.067	0.204	6.576E-2	269	0.014	0.063	2vvfA.pdb.gz	Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2.
14	PDB:2wuxA	0.045	0.153	1.492E-1	213	0.015	0.085	2wuxA.pdb.gz
15	PDB:3o12A	0.056	0.239	1.492E-1	185	0.016	0.103	3o12A.pdb.gz
16	PDB:5njxA	0.036	0.072	1.492E-1	413	0.024	0.070	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
17	PDB:4yarA	0.041	0.090	2.070E-1	429	0.013	0.037	4yarA.pdb.gz
18	PDB:7drtB	0.078	0.152	2.070E-1	496	0.021	0.050	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
19	PDB:5dg2B	0.040	0.256	3.774E-1	131	0.011	0.099	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.
20	PDB:7wrgA	0.027	0.033	6.516E-1	812	0.015	0.022	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LRH4	0.0	2101	1192	0.847	0.848	F1LRH4_RAT Laminin subunit gamma 2 OS=Rattus norvegicus OX=10116 GN=Lamc2 PE=4 SV=1
2	F1MAA7	0.0	603	1607	0.257	0.191	F1MAA7_RAT Laminin subunit gamma 1 OS=Rattus norvegicus OX=10116 GN=Lamc1 PE=1 SV=1
3	F1MD77	0.0	593	1608	0.254	0.188	F1MD77_BOVIN Laminin subunit gamma 1 OS=Bos taurus OX=9913 GN=LAMC1 PE=1 SV=2
4	P02468	0.0	592	1607	0.255	0.189	LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus OX=10090 GN=Lamc1 PE=1 SV=2
5	P11047	0.0	601	1609	0.259	0.192	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
6	Q13753	0.0	2471	1193	1.000	1.000	LAMC2_HUMAN Laminin subunit gamma-2 OS=Homo sapiens OX=9606 GN=LAMC2 PE=1 SV=2
7	Q1LVF0	0.0	714	1593	0.378	0.283	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
8	Q61092	0.0	2043	1191	0.835	0.836	LAMC2_MOUSE Laminin subunit gamma-2 OS=Mus musculus OX=10090 GN=Lamc2 PE=1 SV=2
9	Q9Y6N6	2.77e-165	533	1575	0.233	0.177	LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens OX=9606 GN=LAMC3 PE=1 SV=3
10	P15215	2.93e-150	494	1639	0.220	0.160	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
11	Q9R0B6	2.14e-145	479	1581	0.223	0.168	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
12	F1QPJ1	5.04e-144	477	1643	0.220	0.159	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
13	Q18823	2.07e-121	413	1633	0.285	0.208	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
14	P25391	2.32e-91	327	3075	0.198	0.077	LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens OX=9606 GN=LAMA1 PE=1 SV=2
15	P19137	5.30e-83	301	3083	0.184	0.071	LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus OX=10090 GN=Lama1 PE=1 SV=2
16	G8IHU0	1.47e-77	285	3078	0.181	0.070	G8IHU0_DANRE Laminin alpha 2 chain short splice variant OS=Danio rerio OX=7955 GN=Lama2 PE=1 SV=1
17	Q60675	1.54e-76	281	3118	0.182	0.070	LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus OX=10090 GN=Lama2 PE=1 SV=2
18	P24043	6.36e-76	279	3122	0.193	0.074	LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4
19	Q45H72	3.08e-75	277	3075	0.179	0.069	Q45H72_DANRE Laminin alpha 1 OS=Danio rerio OX=7955 GN=lama1 PE=1 SV=1
20	A0A0G2JWX2	3.30e-74	274	3121	0.179	0.069	A0A0G2JWX2_RAT Laminin subunit alpha 2 OS=Rattus norvegicus OX=10116 GN=Lama2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00052 Laminin_B	5.9e-24	95.9	Laminin B (Domain IV)
2	PF00053 Laminin_EGF	1.9e-37	138.5	Laminin EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264144

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375778	0.978	Laminin subunit beta-3
2	9606.ENSP00000340937	0.969	Collagen alpha-1(XVII) chain
3	9606.ENSP00000324532	0.968	Laminin subunit alpha-3
4	9606.ENSP00000200181	0.962	Integrin beta-4
5	9606.ENSP00000386896	0.957	Integrin alpha-6
6	9606.ENSP00000007722	0.955	Integrin alpha-3
7	9606.ENSP00000442600	0.953	Dystroglycan
8	9606.ENSP00000305714	0.951	Bone morphogenetic protein 1
9	9606.ENSP00000222399	0.949	Laminin subunit beta-1
10	9606.ENSP00000275493	0.949	Epidermal growth factor receptor
11	9606.ENSP00000296585	0.943	Integrin alpha-2
12	9606.ENSP00000252999	0.939	Laminin subunit alpha-5
13	9606.ENSP00000230538	0.936	Laminin subunit alpha-4
14	9606.ENSP00000261769	0.935	Cadherin-1
15	9606.ENSP00000354923	0.934	Dystrophin
16	9606.ENSP00000388325	0.933	Laminin subunit beta-2
17	9606.ENSP00000308208	0.931	Matrix metalloproteinase-14
18	9606.ENSP00000265171	0.930	Pro-epidermal growth factor
19	9606.ENSP00000379350	0.930	Integrin beta-1
20	9606.ENSP00000260227	0.926	Matrilysin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097367	0.997	carbohydrate derivative binding
GO:0008201	0.990	heparin binding
GO:0005198	0.878	structural molecule activity
GO:0005201	0.595	extracellular matrix structural constituent

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.990	anatomical structure development
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.964	cellular process
GO:0048518	0.942	positive regulation of biological process
GO:0009888	0.894	tissue development
GO:0048522	0.889	positive regulation of cellular process
GO:0040012	0.869	regulation of locomotion
GO:2000145	0.754	regulation of cell motility
GO:2000147	0.667	positive regulation of cell motility
GO:0030334	0.661	regulation of cell migration
GO:0032501	0.652	multicellular organismal process
GO:0030335	0.547	positive regulation of cell migration
GO:0007275	0.530	multicellular organism development
GO:0050896	0.503	response to stimulus
GO:0042127	0.440	regulation of cell population proliferation
GO:0071840	0.327	cellular component organization or biogenesis
GO:0016043	0.322	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0032991	0.995	protein-containing complex
GO:0005615	0.875	extracellular space
GO:0005622	0.861	intracellular anatomical structure
GO:0016020	0.788	membrane
GO:0005737	0.778	cytoplasm
GO:0005886	0.685	plasma membrane
GO:0043226	0.617	organelle
GO:0043227	0.590	membrane-bounded organelle
GO:0043231	0.580	intracellular membrane-bounded organelle
GO:0005604	0.408	basement membrane
GO:0043256	0.308	laminin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]