StarFunc result for job id Q13761

User Input

>input (415 residues)
MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLA
DHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAE
LRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREP
RRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELN
PFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPAT
SRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRM
LASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9DGB8	0.466	0.432	1.417E-37	451	0.593	0.545	Q9DGB8.pdb.gz	Q9DGB8_DANRE Runt-related transcription factor OS=Danio rerio OX=7955 GN=runxa PE=2 SV=1
2	AFDB:E1BAC1	0.344	0.470	3.277E-28	302	0.381	0.523	E1BAC1.pdb.gz	E1BAC1_BOVIN RUNX family transcription factor 2 OS=Bos taurus OX=9913 GN=RUNX2 PE=4 SV=3
3	AFDB:Q9W349	0.321	0.163	3.198E-23	826	0.357	0.179	Q9W349.pdb.gz	LOZEN_DROME Protein lozenge OS=Drosophila melanogaster OX=7227 GN=lz PE=2 SV=2
4	AFDB:Q9Z2J9	0.323	0.603	3.776E-20	218	0.275	0.523	Q9Z2J9.pdb.gz	RUNX2_RAT Runt-related transcription factor 2 (Fragments) OS=Rattus norvegicus OX=10116 GN=Runx2 PE=1 SV=2
5	AFDB:G5EFQ5	0.304	0.415	3.065E-19	301	0.248	0.342	G5EFQ5.pdb.gz	RUNX1_CAEEL Runt-related transcription factor rnt-1 OS=Caenorhabditis elegans OX=6239 GN=rnt-1 PE=1 SV=1
6	AFDB:Q91Y13	0.130	0.065	1.127E-2	937	0.125	0.055	Q91Y13.pdb.gz	PCDA7_MOUSE Protocadherin alpha-7 OS=Mus musculus OX=10090 GN=Pcdha7 PE=1 SV=1
7	AFDB:Q8WWV6	0.150	0.122	1.675E-2	532	0.147	0.115	Q8WWV6.pdb.gz	FCAMR_HUMAN High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor OS=Homo sapiens OX=9606 GN=FCAMR PE=1 SV=1
8	PDB:4n6rB	0.142	0.265	1.795E-2	198	0.036	0.076	4n6rB.pdb.gz
9	AFDB:Q91Y12	0.120	0.058	2.101E-2	946	0.125	0.055	Q91Y12.pdb.gz	Q91Y12_MOUSE Protocadherin alpha 8 OS=Mus musculus OX=10090 GN=Pcdha8 PE=2 SV=1
10	AFDB:Q9Y5H8	0.130	0.063	2.223E-2	950	0.142	0.062	Q9Y5H8.pdb.gz	PCDA3_HUMAN Protocadherin alpha-3 OS=Homo sapiens OX=9606 GN=PCDHA3 PE=2 SV=1
11	AFDB:F1QRP2	0.113	0.051	2.489E-2	1135	0.130	0.048	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
12	PDB:2hkaB	0.196	0.486	6.236E-2	130	0.027	0.085	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
13	PDB:4b0mM	0.154	0.270	6.599E-2	212	0.029	0.057	4b0mM.pdb.gz
14	PDB:6rrmA	0.126	0.143	6.599E-2	351	0.041	0.048	6rrmA.pdb.gz	Targeting the Mycobacterium tuberculosis transpeptidase LdtMt2with cysteine-reactive inhibitors including ebselen.
15	PDB:1rowA	0.121	0.372	8.275E-2	107	0.029	0.112	1rowA.pdb.gz
16	PDB:4y5xB	0.142	0.399	1.162E-1	111	0.027	0.099	4y5xB.pdb.gz
17	PDB:5a42A	0.174	0.051	1.230E-1	1597	0.022	0.006	5a42A.pdb.gz
18	PDB:7b0xC	0.151	0.268	1.377E-1	211	0.022	0.043	7b0xC.pdb.gz
19	PDB:4alcA	0.127	0.258	1.727E-1	166	0.019	0.048	4alcA.pdb.gz	Structural and Electronic Snapshots During the Transition from a Cu(II) to Cu(I) Metal Center of a Lytic Polysaccharide Monooxygenase by X-Ray Photo-Reduction.
20	PDB:3oaiA	0.164	0.142	2.047E-1	488	0.046	0.039	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13761	0.0	843	415	1.000	1.000	RUNX3_HUMAN Runt-related transcription factor 3 OS=Homo sapiens OX=9606 GN=RUNX3 PE=1 SV=2
2	Q64131	0.0	747	409	0.918	0.932	RUNX3_MOUSE Runt-related transcription factor 3 OS=Mus musculus OX=10090 GN=Runx3 PE=1 SV=3
3	Q9DEA0	2.61e-172	490	424	0.684	0.670	Q9DEA0_DANRE Runt-related transcription factor OS=Danio rerio OX=7955 GN=Runx3 PE=2 SV=1
4	Q01196	1.21e-168	482	453	0.660	0.605	RUNX1_HUMAN Runt-related transcription factor 1 OS=Homo sapiens OX=9606 GN=RUNX1 PE=1 SV=3
5	Q63046	1.24e-166	477	450	0.658	0.607	RUNX1_RAT Runt-related transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Runx1 PE=1 SV=1
6	Q03347	3.09e-164	471	451	0.651	0.599	RUNX1_MOUSE Runt-related transcription factor 1 OS=Mus musculus OX=10090 GN=Runx1 PE=1 SV=1
7	E1BAD4	5.30e-164	471	480	0.643	0.556	E1BAD4_BOVIN Runt-related transcription factor OS=Bos taurus OX=9913 GN=RUNX1 PE=4 SV=2
8	H9KVB1	1.26e-157	451	389	0.605	0.645	H9KVB1_HUMAN Runt-related transcription factor OS=Homo sapiens OX=9606 GN=RUNX1 PE=1 SV=1
9	Q8UVG3	6.57e-156	450	472	0.660	0.581	Q8UVG3_CHICK Runt-related transcription factor OS=Gallus gallus OX=9031 GN=Runx2 PE=2 SV=1
10	Q8UWC8	5.86e-154	445	472	0.648	0.570	Q8UWC8_CHICK Runt-related transcription factor OS=Gallus gallus OX=9031 PE=2 SV=1
11	A0A0D9SEN7	4.79e-153	443	485	0.634	0.542	A0A0D9SEN7_HUMAN Runt-related transcription factor OS=Homo sapiens OX=9606 GN=RUNX2 PE=1 SV=1
12	F1M9C5	8.34e-137	406	608	0.600	0.410	F1M9C5_RAT RUNX family transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Runx2 PE=4 SV=3
13	Q9DGB8	2.71e-135	397	451	0.595	0.548	Q9DGB8_DANRE Runt-related transcription factor OS=Danio rerio OX=7955 GN=runxa PE=2 SV=1
14	Q13950	1.60e-132	392	521	0.583	0.464	RUNX2_HUMAN Runt-related transcription factor 2 OS=Homo sapiens OX=9606 GN=RUNX2 PE=1 SV=2
15	Q08775	2.07e-130	390	607	0.578	0.395	RUNX2_MOUSE Runt-related transcription factor 2 OS=Mus musculus OX=10090 GN=Runx2 PE=1 SV=2
16	A8MZI9	7.19e-112	330	256	0.412	0.668	A8MZI9_HUMAN RUNX family transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=RUNX1 PE=1 SV=2
17	I3L0L0	1.13e-92	291	542	0.376	0.288	I3L0L0_HUMAN RUNX family transcription factor 2 OS=Homo sapiens OX=9606 GN=RUNX2 PE=1 SV=1
18	Q9DDG3	2.58e-90	274	236	0.325	0.572	Q9DDG3_CHICK Core binding factor alpha 1 (Fragment) OS=Gallus gallus OX=9031 GN=CBFA1 PE=2 SV=1
19	E1BAC1	1.72e-83	259	302	0.304	0.417	E1BAC1_BOVIN RUNX family transcription factor 2 OS=Bos taurus OX=9913 GN=RUNX2 PE=4 SV=3
20	Q9Z2J9	1.35e-68	218	218	0.263	0.500	RUNX2_RAT Runt-related transcription factor 2 (Fragments) OS=Rattus norvegicus OX=10116 GN=Runx2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19406 PKD_5	2.6e+02	12.9	PKD-like domain
2	PF00853 Runt	5.4e-71	247.6	Runt domain
3	PF08504 RunxI	5.7e-41	150.5	Runx inhibition domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382800

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000415151	0.997	Core-binding factor subunit beta
2	9606.ENSP00000332973	0.995	Mothers against decapentaplegic homolog 3
3	9606.ENSP00000344456	0.995	Catenin beta-1
4	9606.ENSP00000177694	0.993	T-box transcription factor TBX21
5	9606.ENSP00000378704	0.980	Bromodomain-containing protein 2
6	9606.ENSP00000263253	0.970	Histone acetyltransferase p300
7	9606.ENSP00000418915	0.966	Cyclin-dependent kinase inhibitor 2A
8	9606.ENSP00000268489	0.962	Zinc finger homeobox protein 3
9	9606.ENSP00000256078	0.952	GTPase KRas
10	9606.ENSP00000341551	0.945	Mothers against decapentaplegic homolog 4
11	9606.ENSP00000376943	0.943	Bcl-2-like protein 11
12	9606.ENSP00000368632	0.939	Trans-acting T-cell-specific transcription factor GATA-3
13	9606.ENSP00000327025	0.937	Nuclear receptor ROR-gamma
14	9606.ENSP00000262435	0.933	E3 ubiquitin-protein ligase SMURF2
15	9606.ENSP00000384849	0.933	Cyclin-dependent kinase inhibitor 1
16	9606.ENSP00000354621	0.932	E3 ubiquitin-protein ligase SMURF1
17	9606.ENSP00000349252	0.928	Integrin alpha-L
18	9606.ENSP00000380227	0.928	Integrin alpha-4
19	9606.ENSP00000221930	0.927	Transforming growth factor beta-1
20	9606.ENSP00000363993	0.923	Proteasome subunit beta type-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0008134	1.000	transcription factor binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000976	0.991	transcription cis-regulatory region binding
GO:0140297	0.976	DNA-binding transcription factor binding
GO:0000977	0.970	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.774	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001221	0.719	transcription coregulator binding
GO:0001222	0.676	transcription corepressor binding
GO:0061629	0.580	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.487	nuclear receptor binding
GO:0042809	0.404	nuclear vitamin D receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0080090	0.988	regulation of primary metabolic process
GO:0009987	0.987	cellular process
GO:0009893	0.983	positive regulation of metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0032502	0.971	developmental process
GO:0030154	0.957	cell differentiation
GO:0048856	0.955	anatomical structure development
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0051171	0.940	regulation of nitrogen compound metabolic process
GO:0048731	0.930	system development
GO:2001141	0.927	regulation of RNA biosynthetic process
GO:0048522	0.923	positive regulation of cellular process
GO:0006355	0.921	regulation of DNA-templated transcription
GO:0010604	0.903	positive regulation of macromolecule metabolic process
GO:0051173	0.872	positive regulation of nitrogen compound metabolic process
GO:0050896	0.768	response to stimulus
GO:0009891	0.755	positive regulation of biosynthetic process
GO:0031325	0.728	positive regulation of cellular metabolic process
GO:0031328	0.687	positive regulation of cellular biosynthetic process
GO:0045893	0.681	positive regulation of DNA-templated transcription
GO:0009888	0.542	tissue development
GO:0061448	0.517	connective tissue development
GO:0001501	0.515	skeletal system development
GO:0051216	0.513	cartilage development
GO:0048519	0.508	negative regulation of biological process
GO:0048523	0.465	negative regulation of cellular process
GO:0008152	0.399	metabolic process
GO:0071704	0.369	organic substance metabolic process
GO:0051239	0.352	regulation of multicellular organismal process
GO:0044238	0.339	primary metabolic process
GO:0051716	0.326	cellular response to stimulus
GO:0006357	0.322	regulation of transcription by RNA polymerase II
GO:0006807	0.318	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0005829	0.996	cytosol
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0140513	0.906	nuclear protein-containing complex
GO:0005667	0.899	transcription regulator complex
GO:0090575	0.749	RNA polymerase II transcription regulator complex
GO:0016513	0.666	core-binding factor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]