StarFunc result for job id Q13769

User Input

>input (683 residues)
MSSESSKKRKPKVIRSDGAPAEGKRNRSDTEQEGKYYSEEAEVDLRDPGRDYELYKYTCQ
ELQRLMAEIQDLKSRGGKDVAIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAK
QKVDAYHLQLQNLLYEVMHLQKEITKCLEFKSKHEEIDLVSLEEFYKEAPPDISKAEVTM
GDPHQQTLARLDWELEQRKRLAEKYRECLSNKEKILKEIEVKKEYLSSLQPRLNSIMQAS
LPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQACDKTLSVAIEGSVDEAKAL
FKPPEDSQDDESDSDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVMLDLKCKDDSVL
HLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQY
QFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLK
TRVQSRLALHKQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTVAHEDYMELHFTKDIV
DAGLAGDTNLYYMALIERGTAKLQAAVVLNPGYSSIPPVFQLCLNWKGEKTNSNDDNIRA
MEGEVNVCYKELCGPWPSHQLLTNQLQRLCVLLDVYLETESHDDSVEGPKEFPQEKMCLR
LFRGPSRMKPFKYNHPQGFFSHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1D6	0.630	0.630	1.139E-101	683	1.000	1.000	A0A024R1D6.pdb.gz
2	PDB:7apkM	0.523	0.649	1.209E-71	549	0.799	0.995	7apkM.pdb.gz
3	PDB:7apkE	0.574	0.746	7.028E-69	523	0.757	0.989	7apkE.pdb.gz
4	AFDB:Q9W1F4	0.502	0.551	1.868E-33	616	0.252	0.279	Q9W1F4.pdb.gz	THOC5_DROME THO complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=thoc5 PE=1 SV=2
5	AFDB:F4K4J0	0.487	0.414	4.341E-30	819	0.272	0.227	F4K4J0.pdb.gz	THO5B_ARATH THO complex subunit 5B OS=Arabidopsis thaliana OX=3702 GN=THO5B PE=1 SV=1
6	AFDB:F4HRC1	0.296	0.409	1.176E-19	452	0.173	0.261	F4HRC1.pdb.gz	THO5A_ARATH THO complex subunit 5A OS=Arabidopsis thaliana OX=3702 GN=THO5A PE=1 SV=1
7	AFDB:Q9USR5	0.168	0.500	2.982E-4	200	0.083	0.285	Q9USR5.pdb.gz	THOC5_SCHPO THO complex subunit tho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tho5 PE=3 SV=1
8	AFDB:O59757	0.197	0.111	1.331E-2	1364	0.120	0.060	O59757.pdb.gz	SPC7_SCHPO Kinetochore protein spc7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spc7 PE=1 SV=1
9	PDB:7v2wJ	0.083	0.183	1.479E-1	236	0.061	0.178	7v2wJ.pdb.gz
10	PDB:7sqcO1	0.084	0.085	3.195E-1	673	0.067	0.068	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
11	AFDB:P53148	0.159	0.128	3.940E-1	917	0.094	0.070	P53148.pdb.gz	SP105_YEAST Spindle pole body component SPC105 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPC105 PE=1 SV=1
12	AFDB:Q14149	0.114	0.086	4.147E-1	939	0.037	0.027	Q14149.pdb.gz	MORC3_HUMAN MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3
13	PDB:7n6g3I	0.083	0.120	4.576E-1	401	0.067	0.115	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:6tz402	0.124	0.396	5.071E-1	176	0.042	0.165	6tz402.pdb.gz
15	AFDB:A0A1D8PGL1	0.101	0.340	5.092E-1	189	0.029	0.106	A0A1D8PGL1.pdb.gz	A0A1D8PGL1_CANAL Endoplasmic reticulum transmembrane protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C202410WA PE=3 SV=1
16	AFDB:Q9FK28	0.082	0.221	5.940E-1	219	0.060	0.187	Q9FK28.pdb.gz	MEM12_ARATH Membrin-12 OS=Arabidopsis thaliana OX=3702 GN=MEMB12 PE=2 SV=1
17	PDB:5n9jG	0.084	0.254	6.226E-1	163	0.023	0.098	5n9jG.pdb.gz
18	PDB:7enal	0.087	0.442	1.095	126	0.026	0.143	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:7enag	0.120	0.406	1.416	166	0.022	0.090	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
20	PDB:5wj9A	0.057	0.073	1.569	479	0.034	0.048	5wj9A.pdb.gz	Human TRPML1 channel structures in open and closed conformations.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13769	0.0	1421	683	1.000	1.000	THOC5_HUMAN THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2
2	Q8BKT7	0.0	1345	683	0.962	0.962	THOC5_MOUSE THO complex subunit 5 homolog OS=Mus musculus OX=10090 GN=Thoc5 PE=1 SV=2
3	Q9W1F4	3.28e-58	209	616	0.266	0.295	THOC5_DROME THO complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=thoc5 PE=1 SV=2
4	F4K4J0	2.73e-42	166	819	0.214	0.178	THO5B_ARATH THO complex subunit 5B OS=Arabidopsis thaliana OX=3702 GN=THO5B PE=1 SV=1
5	F4HRC1	4.79e-36	143	452	0.190	0.288	THO5A_ARATH THO complex subunit 5A OS=Arabidopsis thaliana OX=3702 GN=THO5A PE=1 SV=1
6	Q9USR5	3.95e-11	65.1	200	0.083	0.285	THOC5_SCHPO THO complex subunit tho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tho5 PE=3 SV=1
7	Q57XA3	0.61	35.0	270	0.026	0.067	Q57XA3_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.220 PE=4 SV=1
8	Q7SZL5	1.7	34.3	1338	0.047	0.024	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
9	Q9BXX0	3.1	33.5	1053	0.026	0.017	EMIL2_HUMAN EMILIN-2 OS=Homo sapiens OX=9606 GN=EMILIN2 PE=1 SV=3
10	O14830	5.4	32.7	753	0.041	0.037	PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens OX=9606 GN=PPEF2 PE=1 SV=2
11	O59757	5.4	32.7	1364	0.023	0.012	SPC7_SCHPO Kinetochore protein spc7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spc7 PE=1 SV=1
12	Q9KS12	7.2	32.3	4558	0.031	0.005	MARTX_VIBCH Multifunctional-autoprocessing repeats-in-toxin OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=rtxA PE=1 SV=2
13	O13989	7.7	32.0	505	0.025	0.034	YEG7_SCHPO Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.07c PE=3 SV=2
14	P04035	8.6	32.0	888	0.022	0.017	HMDH_HUMAN 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Homo sapiens OX=9606 GN=HMGCR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09766 FmiP_Thoc5	6.5e-125	428.9	Fms-interacting protein/Thoc5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420306

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245838	0.999	THO complex subunit 2
2	9606.ENSP00000261600	0.999	THO complex subunit 1
3	9606.ENSP00000265097	0.999	THO complex subunit 3
4	9606.ENSP00000295899	0.999	THO complex subunit 7 homolog
5	9606.ENSP00000326531	0.999	THO complex subunit 6 homolog
6	9606.ENSP00000421592	0.999	THO complex subunit 4
7	9606.ENSP00000379475	0.997	Spliceosome RNA helicase DDX39B
8	9606.ENSP00000436679	0.997	Nuclear RNA export factor 1
9	9606.ENSP00000357679	0.995	Chromatin target of PRMT1 protein
10	9606.ENSP00000337632	0.988	SAP domain-containing ribonucleoprotein
11	9606.ENSP00000242776	0.961	ATP-dependent RNA helicase DDX39A
12	9606.ENSP00000364289	0.961	Nuclear cap-binding protein subunit 1
13	9606.ENSP00000269349	0.938	Eukaryotic initiation factor 4A-III
14	9606.ENSP00000241502	0.928	UAP56-interacting factor
15	9606.ENSP00000298875	0.923	Cleavage and polyadenylation specificity factor subunit 2
16	9606.ENSP00000397927	0.904	Polymerase delta-interacting protein 3
17	9606.ENSP00000254998	0.894	NTF2-related export protein 1
18	9606.ENSP00000426978	0.882	Nuclear RNA export factor 5
19	9606.ENSP00000326806	0.877	Nuclear cap-binding protein subunit 2
20	9606.ENSP00000378504	0.876	Nuclear RNA export factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.798	nucleic acid binding
GO:0003723	0.627	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0043170	0.980	macromolecule metabolic process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0010467	0.966	gene expression
GO:0010468	0.962	regulation of gene expression
GO:0048519	0.951	negative regulation of biological process
GO:0048523	0.942	negative regulation of cellular process
GO:0030097	0.941	hemopoiesis
GO:0048522	0.888	positive regulation of cellular process
GO:0051179	0.862	localization
GO:0051171	0.844	regulation of nitrogen compound metabolic process
GO:0080090	0.840	regulation of primary metabolic process
GO:0031323	0.840	regulation of cellular metabolic process
GO:0051234	0.834	establishment of localization
GO:0051252	0.824	regulation of RNA metabolic process
GO:0006913	0.811	nucleocytoplasmic transport
GO:0033036	0.775	macromolecule localization
GO:0006406	0.773	mRNA export from nucleus
GO:0006807	0.571	nitrogen compound metabolic process
GO:0051173	0.511	positive regulation of nitrogen compound metabolic process
GO:0031325	0.511	positive regulation of cellular metabolic process
GO:0010604	0.510	positive regulation of macromolecule metabolic process
GO:0044237	0.501	cellular metabolic process
GO:0044238	0.476	primary metabolic process
GO:0034641	0.413	cellular nitrogen compound metabolic process
GO:1901360	0.400	organic cyclic compound metabolic process
GO:0032501	0.380	multicellular organismal process
GO:0046483	0.358	heterocycle metabolic process
GO:0006725	0.358	cellular aromatic compound metabolic process
GO:0006139	0.336	nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.937	protein-containing complex
GO:0043232	0.763	intracellular non-membrane-bounded organelle
GO:0005737	0.690	cytoplasm
GO:0140513	0.678	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]