StarFunc result for job id Q13794

User Input

>input (54 residues)
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13794	1.000	1.000	2.639E-8	54	1.000	1.000	Q13794.pdb.gz	APR_HUMAN Phorbol-12-myristate-13-acetate-induced protein 1 OS=Homo sapiens OX=9606 GN=PMAIP1 PE=1 SV=1
2	AFDB:A0A6H2U3G7	0.323	0.346	3.206	49	0.222	0.245	A0A6H2U3G7.pdb.gz	A0A6H2U3G7_RANTE Brevinin (Fragment) OS=Rana temporaria OX=8407 GN=Brev PE=4 SV=1
3	AFDB:A0A087X256	0.653	0.042	3.786	1174	0.130	0.006	A0A087X256.pdb.gz	A0A087X256_HUMAN WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=1
4	AFDB:P9WP57	0.395	0.256	3.786	93	0.241	0.140	P9WP57.pdb.gz	CRGA_MYCTU Cell division protein CrgA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=crgA PE=1 SV=1
5	AFDB:Q9VI54	0.712	0.052	5.279	905	0.148	0.009	Q9VI54.pdb.gz	Q9VI54_DROME LD29489p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1965 PE=1 SV=3
6	AFDB:O42931	0.393	0.064	6.233	438	0.130	0.016	O42931.pdb.gz	PRS7_SCHPO 26S proteasome regulatory subunit 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpt1 PE=1 SV=2
7	AFDB:A0A5S6RB44	0.463	0.223	6.773	124	0.056	0.024	A0A5S6RB44.pdb.gz	RTFL3_ORYSJ Small polypeptide ROTUNDIFOLIA LIKE 3 OS=Oryza sativa subsp. japonica OX=39947 GN=RTFL3 PE=3 SV=1
8	AFDB:Q2QMV9	0.435	0.091	6.773	304	0.111	0.020	Q2QMV9.pdb.gz	Q2QMV9_ORYSJ Helix-loop-helix DNA-binding domain containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os12g39850 PE=3 SV=1
9	AFDB:O33272	0.563	0.146	7.998	255	0.130	0.027	O33272.pdb.gz	O33272_MYCTU Possible conserved membrane or secreted protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2969c PE=1 SV=3
10	AFDB:Q9LIC7	0.318	0.120	7.998	188	0.167	0.048	Q9LIC7.pdb.gz	PR1F4_ARATH PRA1 family protein F4 OS=Arabidopsis thaliana OX=3702 GN=PRA1F4 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13794	6.68e-34	110	54	1.000	1.000	APR_HUMAN Phorbol-12-myristate-13-acetate-induced protein 1 OS=Homo sapiens OX=9606 GN=PMAIP1 PE=1 SV=1
2	Q5U777	8.20e-16	66.6	105	0.648	0.333	APR_RAT Phorbol-12-myristate-13-acetate-induced protein 1 OS=Rattus norvegicus OX=10116 GN=Pmaip1 PE=3 SV=1
3	Q9JM54	6.14e-15	64.3	103	0.630	0.330	APR_MOUSE Phorbol-12-myristate-13-acetate-induced protein 1 OS=Mus musculus OX=10090 GN=Pmaip1 PE=1 SV=1
4	Q0GKC8	1.14e-04	37.0	45	0.315	0.378	Q0GKC8_DANRE Noxa OS=Danio rerio OX=7955 GN=zgc:162379 PE=2 SV=1
5	P07259	1.3	28.1	2214	0.222	0.005	PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA2 PE=1 SV=5
6	Q7Z6L1	2.8	26.9	1165	0.185	0.009	TCPR1_HUMAN Tectonin beta-propeller repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=TECPR1 PE=1 SV=1
7	Q8R418	4.2	26.6	1916	0.278	0.008	DICER_MOUSE Endoribonuclease Dicer OS=Mus musculus OX=10090 GN=Dicer1 PE=1 SV=3
8	Q22387	5.2	26.2	445	0.315	0.038	Q22387_CAEEL Centrosomal protein of 162 kDa OS=Caenorhabditis elegans OX=6239 GN=CELE_T11B7.1 PE=1 SV=2
9	Q9SCK1	6.3	25.8	94	0.259	0.149	LSU1_ARATH Protein RESPONSE TO LOW SULFUR 1 OS=Arabidopsis thaliana OX=3702 GN=LSU1 PE=1 SV=1
10	O42998	7.1	25.8	1919	0.315	0.009	SIP1_SCHPO Pof6 interactor protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sip1 PE=1 SV=1
11	Q9LQR8	9.4	25.8	487	0.185	0.021	PSD3B_ARATH 26S proteasome non-ATPase regulatory subunit 3 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPN3B PE=1 SV=2
12	Q20766	9.9	25.4	1406	0.204	0.008	Q20766_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gtl-2 PE=4 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15150 PMAIP1	1.8e-32	122.2	Phorbol-12-myristate-13-acetate-induced

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326119

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302564	0.999	Bcl-2-like protein 1
2	9606.ENSP00000358022	0.999	Induced myeloid leukemia cell differentiation protein Mcl-1
3	9606.ENSP00000267953	0.993	Bcl-2-related protein A1
4	9606.ENSP00000376943	0.984	Bcl-2-like protein 11
5	9606.ENSP00000269305	0.983	Cellular tumor antigen p53
6	9606.ENSP00000381185	0.976	Apoptosis regulator Bcl-2
7	9606.ENSP00000250405	0.970	Bcl-2-like protein 2
8	9606.ENSP00000404503	0.949	Bcl-2-binding component 3
9	9606.ENSP00000345571	0.930	Transcription factor E2F1
10	9606.ENSP00000318822	0.907	BH3-interacting domain death agonist
11	9606.ENSP00000364519	0.904	Transcription factor Dp-1
12	9606.ENSP00000384924	0.873	Protein Bop
13	9606.ENSP00000452479	0.838	BCL2L2-PABPN1 readthrough
14	9606.ENSP00000257572	0.828	Activator of apoptosis harakiri
15	9606.ENSP00000260442	0.825	Bcl-2-like protein 10
16	9606.ENSP00000346697	0.811	Bcl-2-modifying factor
17	9606.ENSP00000216115	0.787	Bcl-2-interacting killer
18	9606.ENSP00000307786	0.765	Cytochrome c
19	9606.ENSP00000311032	0.742	Caspase-3
20	9606.ENSP00000479618	0.738	Myc proto-oncogene protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0043085	0.985	positive regulation of catalytic activity
GO:0097190	0.985	apoptotic signaling pathway
GO:0043065	0.984	positive regulation of apoptotic process
GO:0051336	0.983	regulation of hydrolase activity
GO:0080135	0.980	regulation of cellular response to stress
GO:1902533	0.980	positive regulation of intracellular signal transduction
GO:0035556	0.979	intracellular signal transduction
GO:0030162	0.978	regulation of proteolysis
GO:0031323	0.976	regulation of cellular metabolic process
GO:0010604	0.976	positive regulation of macromolecule metabolic process
GO:0051247	0.974	positive regulation of protein metabolic process
GO:0016043	0.970	cellular component organization
GO:0051345	0.968	positive regulation of hydrolase activity
GO:0006950	0.966	response to stress
GO:0033554	0.961	cellular response to stress
GO:0071704	0.960	organic substance metabolic process
GO:0010638	0.960	positive regulation of organelle organization
GO:0031325	0.955	positive regulation of cellular metabolic process
GO:0007005	0.946	mitochondrion organization
GO:2000116	0.941	regulation of cysteine-type endopeptidase activity
GO:0009605	0.938	response to external stimulus
GO:0042221	0.932	response to chemical
GO:2001233	0.932	regulation of apoptotic signaling pathway
GO:0010952	0.926	positive regulation of peptidase activity
GO:0070887	0.922	cellular response to chemical stimulus
GO:2001056	0.922	positive regulation of cysteine-type endopeptidase activity
GO:0097193	0.919	intrinsic apoptotic signaling pathway
GO:2001242	0.914	regulation of intrinsic apoptotic signaling pathway
GO:0006807	0.909	nitrogen compound metabolic process
GO:0043170	0.901	macromolecule metabolic process
GO:0043281	0.899	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0044238	0.896	primary metabolic process
GO:0010821	0.896	regulation of mitochondrion organization
GO:1901564	0.888	organonitrogen compound metabolic process
GO:2001235	0.885	positive regulation of apoptotic signaling pathway
GO:0043280	0.884	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0090199	0.882	regulation of release of cytochrome c from mitochondria
GO:0009628	0.881	response to abiotic stimulus
GO:0010033	0.874	response to organic substance
GO:0010822	0.874	positive regulation of mitochondrion organization
GO:0072331	0.871	signal transduction by p53 class mediator
GO:2001244	0.870	positive regulation of intrinsic apoptotic signaling pathway
GO:0065008	0.869	regulation of biological quality
GO:0051179	0.867	localization
GO:1905897	0.867	regulation of response to endoplasmic reticulum stress
GO:0019538	0.866	protein metabolic process
GO:0051641	0.861	cellular localization
GO:0044237	0.851	cellular metabolic process
GO:0051234	0.846	establishment of localization
GO:0046902	0.839	regulation of mitochondrial membrane permeability
GO:1905898	0.833	positive regulation of response to endoplasmic reticulum stress
GO:2001236	0.814	regulation of extrinsic apoptotic signaling pathway
GO:0062012	0.813	regulation of small molecule metabolic process
GO:2001020	0.813	regulation of response to DNA damage stimulus
GO:1901796	0.762	regulation of signal transduction by p53 class mediator
GO:0048519	0.734	negative regulation of biological process
GO:0072332	0.714	intrinsic apoptotic signaling pathway by p53 class mediator
GO:0006109	0.705	regulation of carbohydrate metabolic process
GO:0010675	0.694	regulation of cellular carbohydrate metabolic process
GO:0043516	0.686	regulation of DNA damage response, signal transduction by p53 class mediator
GO:2001238	0.674	positive regulation of extrinsic apoptotic signaling pathway
GO:1902041	0.670	regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0071496	0.649	cellular response to external stimulus
GO:0010906	0.648	regulation of glucose metabolic process
GO:0031667	0.640	response to nutrient levels
GO:0062013	0.619	positive regulation of small molecule metabolic process
GO:0048523	0.618	negative regulation of cellular process
GO:0042594	0.606	response to starvation
GO:0071453	0.536	cellular response to oxygen levels
GO:0009056	0.432	catabolic process
GO:0009057	0.367	macromolecule catabolic process
GO:1901698	0.354	response to nitrogen compound
GO:1901565	0.336	organonitrogen compound catabolic process
GO:0006974	0.330	cellular response to DNA damage stimulus
GO:0031669	0.322	cellular response to nutrient levels
GO:2001022	0.317	positive regulation of response to DNA damage stimulus
GO:0006508	0.312	proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0005739	1.000	mitochondrion
GO:0031090	0.995	organelle membrane
GO:0098588	0.992	bounding membrane of organelle
GO:0031967	0.992	organelle envelope
GO:0005740	0.975	mitochondrial envelope
GO:0031966	0.951	mitochondrial membrane
GO:0019867	0.949	outer membrane
GO:0031968	0.943	organelle outer membrane
GO:0005741	0.932	mitochondrial outer membrane
GO:0097136	0.666	Bcl-2 family protein complex
GO:0070013	0.528	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]