StarFunc result for job id Q13796

User Input

>input (1616 residues)
MEGAEPRARPERLAEAETRAADGGRLVEVQLSGGAPWGFTLKGGREHGEPLVITKIEEGS
KAAAVDKLLAGDEIVGINDIGLSGFRQEAICLVKGSHKTLKLVVKRRSELGWRPHSWHAT
KFSDSHPELAASPFTSTSGCPSWSGRHHASSSSHDLSSSWEQTNLQRTLDHFSSLGSVDS
LDHPSSRLSVAKSNSSIDHLGSHSKRDSAYGSFSTSSSTPDHTLSKADTSSAENILYTVG
LWEAPRQGGRQAQAAGDPQGSEEKLSCFPPRVPGDSGKGPRPEYNAEPKLAAPGRSNFGP
VWYVPDKKKAPSSPPPPPPPLRSDSFAATKSHEKAQGPVFSEAAAAQHFTALAQAQPRGD
RRPELTDRPWRSAHPGSLGKGSGGPGCPQEAHADGSWPPSKDGASSRLQASLSSSDVRFP
QSPHSGRHPPLYSDHSPLCADSLGQEPGAASFQNDSPPQVRGLSSCDQKLGSGWQGPRPC
VQGDLQAAQLWAGCWPSDTALGALESLPPPTVGQSPRHHLPQPEGPPDARETGRCYPLDK
GAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQEGKRRPES
SPEDSATRPPPFDAHVGKPTRRSDRFATTLRNEIQMHRAKLQKSRSTVALTAAGEAEDGT
GRWRAGLGGGTQEGPLAGTYKDHLKEAQARVLRATSFKRRDLDPNPGDLYPESLEHRMGD
PDTVPHFWEAGLAQPPSSTSGGPHPPRIGGRRRFTAEQKLKSYSEPEKMNEVGLTRGYSP
HQHPRTSEDTVGTFADRWKFFEETSKPVPQRPAQKQALHGIPRDKPERPRTAGRTCEGTE
PWSRTTSLGDSLNAHSAAEKAGTSDLPRRLGTFAEYQASWKEQRKPLEARSSGRCHSADD
ILDVSLDPQERPQHVHGRSRSSPSTDHYKQEASVELRRQAGDPGEPREELPSAVRAEEGQ
STPRQADAQCREGSPGSQQHPPSQKAPNPPTFSELSHCRGAPELPREGRGRAGTLPRDYR
YSEESTPADLGPRAQSPGSPLHARGQDSWPVSSALLSKRPAPQRPPPPKREPRRYRATDG
APADAPVGVLGRPFPTPSPASLDVYVARLSLSHSPSVFSSAQPQDTPKATVCERGSQHVS
GDASRPLPEALLPPKQQHLRLQTATMETSRSPSPQFAPQKLTDKPPLLIQDEDSTRIERV
MDNNTTVKMVPIKIVHSESQPEKESRQSLACPAEPPALPHGLEKDQIKTLSTSEQFYSRF
CLYTRQGAEPEAPHRAQPAEPQPLGTQVPPEKDRCTSPPGLSYMKAKEKTVEDLKSEELA
REIVGKDKSLADILDPSVKIKTTMDLMEGIFPKDEHLLEEAQQRRKLLPKIPSPRSTEER
KEEPSVPAAVSLATNSTYYSTSAPKAELLIKMKDLQEQQEHEEDSGSDLDHDLSVKKQEL
IESISRKLQVLREARESLLEDVQANTVLGAEVEAIVKGVCKPSEFDKFRMFIGDLDKVVN
LLLSLSGRLARVENALNNLDDGASPGDRQSLLEKQRVLIQQHEDAKELKENLDRRERIVF
DILANYLSEESLADYEHFVKMKSALIIEQRELEDKIHLGEEQLKCLLDSLQPERGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2ALU4	0.255	0.274	0.000	1481	0.632	0.690	A2ALU4.pdb.gz	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
2	AFDB:Q13796	1.000	1.000	0.000	1616	1.000	1.000	Q13796.pdb.gz	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
3	AFDB:Q09JY9	0.218	0.206	4.246E-83	1726	0.472	0.441	Q09JY9.pdb.gz	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
4	AFDB:Q9QXN0	0.175	0.145	8.995E-49	1986	0.343	0.279	Q9QXN0.pdb.gz	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
5	AFDB:Q9ULL8	0.130	0.140	7.597E-35	1493	0.275	0.298	Q9ULL8.pdb.gz	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
6	AFDB:Q1W617	0.132	0.143	9.422E-35	1475	0.249	0.273	Q1W617.pdb.gz	SHRM4_MOUSE Protein Shroom4 OS=Mus musculus OX=10090 GN=Shroom4 PE=1 SV=1
7	AFDB:A0A0R4IS11	0.060	0.062	1.135E-22	1565	0.238	0.245	A0A0R4IS11.pdb.gz
8	AFDB:A1Z9P3	0.145	0.148	1.054E-14	1576	0.166	0.171	A1Z9P3.pdb.gz	SHRM_DROME Protein Shroom OS=Drosophila melanogaster OX=7227 GN=Shrm PE=1 SV=2
9	AFDB:F1RCC9	0.056	0.074	7.015E-8	1179	0.123	0.169	F1RCC9.pdb.gz	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
10	AFDB:D4A702	0.067	0.084	9.181E-8	1262	0.134	0.171	D4A702.pdb.gz	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
11	PDB:6t36A	0.050	0.805	4.555E-6	93	0.019	0.333	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
12	PDB:7pc3A	0.052	0.201	1.336E-5	405	0.015	0.062	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:5n7dA	0.056	0.205	3.714E-5	423	0.015	0.059	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
14	PDB:7p70A	0.051	0.199	6.712E-5	407	0.016	0.064	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:7p73A	0.049	0.184	7.474E-5	420	0.014	0.052	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:2xkxA	0.051	0.112	1.504E-4	721	0.015	0.035	2xkxA.pdb.gz
17	PDB:7qqmA	0.052	0.194	1.587E-4	413	0.014	0.053	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7qqnC	0.050	0.186	1.866E-4	414	0.015	0.058	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7pc5A	0.050	0.192	1.162E-3	405	0.015	0.062	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pe9I	0.049	0.235	1.787E-3	317	0.013	0.066	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ALU4	0.0	1045	1481	0.379	0.414	SHRM2_MOUSE Protein Shroom2 OS=Mus musculus OX=10090 GN=Shroom2 PE=1 SV=1
2	Q09JY9	0.0	1202	1726	0.487	0.456	SHRM2_XENTR Protein Shroom2 OS=Xenopus tropicalis OX=8364 GN=shroom2 PE=2 SV=1
3	Q13796	0.0	3266	1616	1.000	1.000	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
4	Q9QXN0	4.41e-94	340	1986	0.110	0.090	SHRM3_MOUSE Protein Shroom3 OS=Mus musculus OX=10090 GN=Shroom3 PE=1 SV=2
5	Q27IV2	6.76e-93	336	1788	0.106	0.096	SHRM3_XENLA Protein Shroom3 OS=Xenopus laevis OX=8355 GN=shroom3 PE=2 SV=1
6	Q9ULL8	2.96e-69	260	1493	0.085	0.092	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
7	Q1W617	1.71e-66	251	1475	0.081	0.089	SHRM4_MOUSE Protein Shroom4 OS=Mus musculus OX=10090 GN=Shroom4 PE=1 SV=1
8	K7X477	4.47e-42	172	1600	0.080	0.081	K7X477_DANRE Protein Shroom3 OS=Danio rerio OX=7955 GN=shroom3v2 PE=2 SV=1
9	A1Z9P3	4.57e-18	93.6	1576	0.038	0.039	SHRM_DROME Protein Shroom OS=Drosophila melanogaster OX=7227 GN=Shrm PE=1 SV=2
10	Q5SX79	2.81e-13	77.4	823	0.064	0.126	SHRM1_MOUSE Protein Shroom1 OS=Mus musculus OX=10090 GN=Shroom1 PE=1 SV=2
11	U3JAM7	3.35e-10	67.8	1184	0.022	0.030	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
12	Q91YE8	1.09e-09	65.9	1087	0.022	0.033	SYNP2_MOUSE Synaptopodin-2 OS=Mus musculus OX=10090 GN=Synpo2 PE=1 SV=2
13	Q9UMS6	2.46e-09	64.7	1093	0.020	0.030	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
14	D4A702	4.96e-09	63.9	1262	0.020	0.026	SYNP2_RAT Synaptopodin-2 OS=Rattus norvegicus OX=10116 GN=Synpo2 PE=1 SV=2
15	A0A140LH61	1.57e-08	62.4	1151	0.023	0.032	A0A140LH61_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=1
16	Q7ZVD3	2.44e-08	59.7	291	0.020	0.110	Q7ZVD3_DANRE LIM domain-binding protein 3 OS=Danio rerio OX=7955 GN=ZASP PE=1 SV=1
17	F1RCC9	3.52e-08	61.2	1179	0.020	0.028	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
18	O70209	5.99e-08	58.9	316	0.022	0.114	PDLI3_MOUSE PDZ and LIM domain protein 3 OS=Mus musculus OX=10090 GN=Pdlim3 PE=1 SV=1
19	Q8BWB1	6.60e-08	60.1	975	0.019	0.031	SYP2L_MOUSE Synaptopodin 2-like protein OS=Mus musculus OX=10090 GN=Synpo2l PE=1 SV=1
20	Q9PU47	1.10e-07	57.8	315	0.024	0.121	PDLI3_CHICK PDZ and LIM domain protein 3 OS=Gallus gallus OX=9031 GN=PDLIM3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08688 ASD1	3.9e-50	182.2	Apx/Shroom domain ASD1
2	PF08687 ASD2	1.6e-110	380.9	Apx/Shroom domain ASD2
3	PF00595 PDZ	4.6e-07	41.4	PDZ domain
4	PF17820 PDZ_6	1.7	20.0	PDZ domain
5	PF02163 Peptidase_M50	28	15.5	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370299

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281537	0.934	Tight junction protein ZO-1
2	9606.ENSP00000382697	0.934	Rho-associated protein kinase 1
3	9606.ENSP00000417161	0.795	G-protein coupled receptor 143
4	9606.ENSP00000370621	0.716	Zinc finger BED domain-containing protein 1
5	9606.ENSP00000386331	0.715	Unconventional myosin-VIIa
6	9606.ENSP00000370242	0.706	Protein WWC3
7	9606.ENSP00000433205	0.672	BRCA2-interacting transcriptional repressor EMSY
8	9606.ENSP00000317872	0.655	E3 ubiquitin-protein ligase RBBP6
9	9606.ENSP00000317985	0.635	Rho-associated protein kinase 2
10	9606.ENSP00000384109	0.616	Cullin-4B
11	9606.ENSP00000245105	0.606	SH3 domain and tetratricopeptide repeats 1
12	9606.ENSP00000249016	0.599	Melanin-concentrating hormone receptor 1
13	9606.ENSP00000429374	0.582	Ribosomal protein S20
14	9606.ENSP00000440163	0.561	Protein FAM9A
15	9606.ENSP00000301972	0.559	Rab effector MyRIP
16	9606.ENSP00000370088	0.540	Amelogenin, X isoform
17	9606.ENSP00000346659	0.519	P protein
18	9606.ENSP00000217964	0.507	F-box-like/WD repeat-containing protein TBL1X

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0022857	0.807	transmembrane transporter activity
GO:0022803	0.802	passive transmembrane transporter activity
GO:0015075	0.798	monoatomic ion transmembrane transporter activity
GO:0008324	0.780	monoatomic cation transmembrane transporter activity
GO:0015267	0.777	channel activity
GO:0015318	0.773	inorganic molecular entity transmembrane transporter activity
GO:0046873	0.759	metal ion transmembrane transporter activity
GO:0005216	0.756	monoatomic ion channel activity
GO:0005261	0.750	monoatomic cation channel activity
GO:1901702	0.741	salt transmembrane transporter activity
GO:0022834	0.741	ligand-gated channel activity
GO:0015081	0.734	sodium ion transmembrane transporter activity
GO:0015276	0.732	ligand-gated monoatomic ion channel activity
GO:0015280	0.624	ligand-gated sodium channel activity
GO:0008092	0.358	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.968	biological regulation
GO:0050794	0.956	regulation of cellular process
GO:0071840	0.935	cellular component organization or biogenesis
GO:0016043	0.933	cellular component organization
GO:0006996	0.807	organelle organization
GO:0032501	0.718	multicellular organismal process
GO:0032502	0.580	developmental process
GO:0048856	0.557	anatomical structure development
GO:0050896	0.351	response to stimulus
GO:0048519	0.324	negative regulation of biological process
GO:0007275	0.301	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0005856	1.000	cytoskeleton
GO:0016020	0.992	membrane
GO:0015629	0.990	actin cytoskeleton
GO:0005938	0.987	cell cortex
GO:0005886	0.982	plasma membrane
GO:0031982	0.980	vesicle
GO:0005576	0.976	extracellular region
GO:0030864	0.970	cortical actin cytoskeleton
GO:0005615	0.943	extracellular space
GO:0043231	0.935	intracellular membrane-bounded organelle
GO:0043230	0.866	extracellular organelle
GO:0070062	0.864	extracellular exosome
GO:0005829	0.592	cytosol
GO:0030054	0.522	cell junction
GO:0005634	0.340	nucleus
GO:0012505	0.313	endomembrane system
GO:0070161	0.305	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.734	Na(+)(in) = Na(+)(out)

[back to server]