StarFunc result for job id Q13813

User Input

>input (2472 residues)
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELASDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQA
WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERG
ACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEAL
LASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKDKRD
TINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRDLTGVQ
NLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKELKQLAA
ARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFT
VHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDENSAFLQ
FNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALK
DQLLAAKHVQSKAIEARHASLMKRWSQLLANSAARKKKLLEAQSHFRKVEDLFLTFAKKA
SAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSF
RVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHANAFHQW
IQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDN
KYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKS
GRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRET
ENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAF
DYVEFTRSLFVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A678	0.505	0.514	0.000	2416	0.548	0.560	D4A678.pdb.gz	D4A678_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=4
2	AFDB:F1R446	0.472	0.471	0.000	2480	0.902	0.899	F1R446.pdb.gz
3	AFDB:P02549	0.408	0.416	0.000	2419	0.551	0.563	P02549.pdb.gz	SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1 PE=1 SV=5
4	AFDB:P07751	0.371	0.370	0.000	2477	0.962	0.960	P07751.pdb.gz	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3
5	AFDB:P13395	0.352	0.359	0.000	2415	0.640	0.655	P13395.pdb.gz	SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2
6	AFDB:Q21408	0.390	0.395	0.000	2432	0.581	0.591	Q21408.pdb.gz	Q21408_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
7	AFDB:Q00963	0.123	0.129	1.666E-67	2291	0.206	0.222	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
8	AFDB:O15020	0.148	0.152	3.160E-67	2390	0.204	0.211	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
9	AFDB:Q01082	0.133	0.138	3.160E-67	2364	0.206	0.216	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
10	AFDB:P11277	0.148	0.170	4.694E-66	2137	0.197	0.227	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
11	PDB:1sjjA	0.101	0.264	3.457E-20	863	0.072	0.207	1sjjA.pdb.gz
12	PDB:4d1eA	0.114	0.298	8.630E-20	859	0.085	0.246	4d1eA.pdb.gz
13	PDB:5m6sA	0.038	0.782	1.438E-5	98	0.038	0.969	5m6sA.pdb.gz
14	PDB:1a2xA	0.044	0.450	8.960E-5	158	0.016	0.253	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
15	PDB:7sqcR1	0.035	0.040	1.234E-4	2080	0.100	0.119	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:7sukSP	0.046	0.050	2.811E-4	2234	0.102	0.113	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
17	PDB:7n6g1N	0.038	0.041	3.533E-4	2179	0.098	0.111	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
18	PDB:5zorA	0.034	0.386	4.243E-4	149	0.012	0.195	5zorA.pdb.gz
19	PDB:7z8fe	0.065	0.044	6.403E-4	4579	0.096	0.052	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
20	PDB:5d43A	0.039	0.442	9.232E-4	150	0.015	0.240	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0D9SF54	4984	2457	0.992	0.998	A0A0D9SF54_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
2	A0A0D9SGF6	5021	2498	1.000	0.990	A0A0D9SGF6_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
3	A0A384P5S9	4988	2452	0.992	1.000	A0A384P5S9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
4	A0A8J8Y4Y9	1774	2339	0.409	0.432	A0A8J8Y4Y9_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=1
5	A3FG33	4568	2480	0.903	0.900	A3FG33_DANRE Alpha II-spectrin OS=Danio rerio OX=7955 GN=wu:fa20e05 PE=2 SV=1
6	A8JNJ6	634	4337	0.186	0.106	A8JNJ6_DROME Karst, isoform E OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=2
7	D4A678	2607	2415	0.551	0.564	D4A678_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=4
8	G4S034	2872	2427	0.582	0.593	G4S034_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
9	M9PBL6	634	4321	0.186	0.107	M9PBL6_DROME Karst, isoform G OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1
10	P02549	2625	2419	0.555	0.567	SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1 PE=1 SV=5
11	P07751	4870	2477	0.963	0.961	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3
12	P08032	2586	2415	0.547	0.560	SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus OX=10090 GN=Spta1 PE=1 SV=3
13	P13395	3207	2415	0.644	0.659	SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster OX=7227 GN=alpha-Spec PE=1 SV=2
14	P16086	4978	2472	0.986	0.986	SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Sptan1 PE=1 SV=2
15	P16546	4967	2472	0.984	0.984	SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptan1 PE=1 SV=4
16	Q13813	5039	2472	1.000	1.000	SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3
17	Q21408	2868	2432	0.582	0.592	Q21408_CAEEL Spectrin alpha chain OS=Caenorhabditis elegans OX=6239 GN=spc-1 PE=1 SV=2
18	Q6XDA1	2542	2385	0.543	0.563	Q6XDA1_RAT Erythroid spectrin alpha OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=1
19	Q7KV69	636	4118	0.186	0.112	Q7KV69_DROME Karst, isoform B OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1
20	Q7KV70	635	4207	0.186	0.110	Q7KV70_DROME Karst, isoform C OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	1.1e-09	48.2	EF hand
2	PF13202 EF-hand_5	0.0077	26.9	EF hand
3	PF13405 EF-hand_6	1.1e-06	39.0	EF-hand domain
4	PF13499 EF-hand_7	2.2e-08	45.8	EF-hand domain pair
5	PF13833 EF-hand_8	1.1e-05	36.4	EF-hand domain pair
6	PF08726 EFhand_Ca_insen	2.3e-24	96.6	Ca2+ insensitive EF hand
7	PF05120 GvpG	1e+02	14.4	Gas vesicle protein G
8	PF02630 SCO1-SenC	59	15.1	SCO1/SenC
9	PF00018 SH3_1	1.6e-11	55.0	SH3 domain
10	PF17902 SH3_10	22	16.5	SH3 domain
11	PF07653 SH3_2	0.016	26.3	Variant SH3 domain
12	PF08239 SH3_3	2.1	20.2	Bacterial SH3 domain
13	PF14604 SH3_9	1.3e-07	42.8	Variant SH3 domain
14	PF00435 Spectrin	0	1572.5	Spectrin repeat
15	PF11401 Tetrabrachion	3.6e+02	12.6	Tetrabrachion

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349259	0.999	Spectrin beta chain, non-erythrocytic 1
2	9606.ENSP00000311032	0.978	Caspase-3
3	9606.ENSP00000317790	0.975	Spectrin beta, non-erythrocytic 5
4	9606.ENSP00000431984	0.971	Calpain-1 catalytic subunit
5	9606.ENSP00000432568	0.962	Spectrin beta chain, non-erythrocytic 2
6	9606.ENSP00000355645	0.960	Actin, alpha skeletal muscle
7	9606.ENSP00000349588	0.949	Ankyrin-2
8	9606.ENSP00000451752	0.942	Spectrin beta chain, erythrocytic
9	9606.ENSP00000362680	0.940	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000245932	0.934	Vasodilator-stimulated phosphoprotein
11	9606.ENSP00000252699	0.934	Alpha-actinin-4
12	9606.ENSP00000356042	0.932	Ezrin
13	9606.ENSP00000367910	0.932	Fanconi anemia group G protein
14	9606.ENSP00000400175	0.931	Transforming protein RhoA
15	9606.ENSP00000246533	0.930	Calpain small subunit 1
16	9606.ENSP00000358548	0.927	GTPase NRas
17	9606.ENSP00000377941	0.925	Alpha-actinin-1
18	9606.ENSP00000316029	0.922	Talin-1
19	9606.ENSP00000407586	0.922	GTPase HRas
20	9606.ENSP00000422007	0.922	Alpha-actinin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0044877	0.999	protein-containing complex binding
GO:0030507	0.977	spectrin binding
GO:0005200	0.912	structural constituent of cytoskeleton
GO:0050839	0.719	cell adhesion molecule binding
GO:0015631	0.495	tubulin binding
GO:0008017	0.476	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071840	0.985	cellular component organization or biogenesis
GO:0016043	0.970	cellular component organization
GO:0032501	0.947	multicellular organismal process
GO:0007275	0.925	multicellular organism development
GO:0048869	0.884	cellular developmental process
GO:0061024	0.843	membrane organization
GO:0048731	0.808	system development
GO:0050789	0.758	regulation of biological process
GO:0007399	0.707	nervous system development
GO:0030154	0.514	cell differentiation
GO:0050794	0.488	regulation of cellular process
GO:0006996	0.459	organelle organization
GO:0021700	0.422	developmental maturation
GO:0030029	0.387	actin filament-based process
GO:0048468	0.383	cell development
GO:0050896	0.341	response to stimulus
GO:0007010	0.336	cytoskeleton organization
GO:0030036	0.302	actin cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.996	membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0005856	0.995	cytoskeleton
GO:0016020	0.993	membrane
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0071944	0.977	cell periphery
GO:0005886	0.964	plasma membrane
GO:0032991	0.935	protein-containing complex
GO:0030054	0.836	cell junction
GO:0012505	0.821	endomembrane system
GO:0015630	0.795	microtubule cytoskeleton
GO:0005634	0.644	nucleus
GO:0031982	0.590	vesicle
GO:0042995	0.563	cell projection
GO:0015629	0.471	actin cytoskeleton
GO:0070013	0.435	intracellular organelle lumen
GO:0043005	0.422	neuron projection
GO:0005938	0.404	cell cortex
GO:0070161	0.399	anchoring junction
GO:0099512	0.368	supramolecular fiber
GO:0030016	0.351	myofibril
GO:0031981	0.329	nuclear lumen
GO:0030424	0.318	axon
GO:0070062	0.315	extracellular exosome
GO:0045202	0.302	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]