StarFunc result for job id Q13822

User Input

>input (863 residues)
MARRSSFQSCQIISLFTFAVGVNICLGFTAHRIKRAEGWEEGPPTVLSDSPWTNISGSCK
GRCFELQEAGPPDCRCDNLCKSYTSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC
SEDCLARGDCCTNYQVVCKGESHWVDDDCEEIKAAECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDHER
PSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDH
GMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQH
FKPYLKQHLPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPSGKCFFQGDHGFDNK
VNSMQTVFVGYGSTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTF
RPTMPEEVTRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYG
RPAVLYRTRYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSSVPDHLTSCVRPDVRVS
PSFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVL
VKKYASERNGVNVISGPIFDYDYDGLHDTEDKIKQYVEGSSIPVPTHYYSIITSCLDFTQ
PADKCDGPLSVSSFILPHRPDNEESCNSSEDESKWVEELMKMHTARVRDIEHLTSLDFFR
KTSRSYPEILTLKTYLHTYESEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3wayA	0.907	0.995	0.000	787	0.864	0.948	3wayA.pdb.gz	Screening and X-ray Crystal Structure-based Optimization of Autotaxin (ENPP2) Inhibitors, Using a Newly Developed Fluorescence Probe
2	PDB:5s9mA	0.921	0.982	0.000	809	0.883	0.942	5s9mA.pdb.gz	Crystal Structure of a rat Autotaxin complex
3	AFDB:E2RUH0	0.948	0.952	0.000	859	0.834	0.838	E2RUH0.pdb.gz	E2RUH0_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2, long form OS=Gallus gallus OX=9031 GN=Enpp2 PE=2 SV=1
4	AFDB:O14638	0.856	0.844	0.000	875	0.431	0.425	O14638.pdb.gz	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
5	AFDB:P97675	0.854	0.842	0.000	875	0.445	0.439	P97675.pdb.gz	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
6	AFDB:Q13822	1.000	1.000	0.000	863	1.000	1.000	Q13822.pdb.gz	ENPP2_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Homo sapiens OX=9606 GN=ENPP2 PE=1 SV=3
7	AFDB:Q64610	0.966	0.940	0.000	887	0.939	0.913	Q64610.pdb.gz	ENPP2_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Rattus norvegicus OX=10116 GN=Enpp2 PE=1 SV=2
8	AFDB:Q6PGY9	0.939	0.953	0.000	850	0.655	0.665	Q6PGY9.pdb.gz	Q6PGY9_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 2 OS=Danio rerio OX=7955 GN=atx PE=2 SV=1
9	PDB:6c01A	0.851	0.896	2.755E-102	819	0.428	0.451	6c01A.pdb.gz	Structural basis for nucleotide recognition by the ectoenzyme CD203c.
10	AFDB:P22413	0.836	0.781	2.607E-100	925	0.441	0.412	P22413.pdb.gz	ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2
11	AFDB:B0JZL7	0.840	0.825	3.843E-100	878	0.447	0.440	B0JZL7.pdb.gz	B0JZL7_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Danio rerio OX=7955 GN=si:ch211-142e24.2 PE=1 SV=1
12	PDB:6wevAbA	0.830	0.875	1.622E-99	817	0.431	0.455	6wevAbA.pdb.gz	Crystal structures of human ENPP1 in apo and bound forms.
13	AFDB:P06802	0.837	0.799	1.265E-98	906	0.429	0.408	P06802.pdb.gz	ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus OX=10090 GN=Enpp1 PE=1 SV=4
14	PDB:4b56A	0.793	0.837	4.265E-94	816	0.417	0.441	4b56A.pdb.gz	Structure of Npp1, an Ectonucleotide Pyrophosphatase/Phosphodiesterase Involved in Tissue Calcification.
15	PDB:6g4gD	0.803	0.886	7.850E-94	781	0.429	0.474	6g4gD.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
16	PDB:6g4gB	0.780	0.884	5.021E-90	759	0.418	0.476	6g4gB.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
17	PDB:6g4gC	0.751	0.871	6.992E-88	742	0.408	0.474	6g4gC.pdb.gz	Crystallization of ectonucleotide phosphodiesterase/pyrophosphatase-3 and orientation of the SMB domains in the full-length ectodomain.
18	PDB:6xkdB	0.734	0.927	1.640E-78	681	0.363	0.460	6xkdB.pdb.gz	Structure-Aided Development of Small-Molecule Inhibitors of ENPP1, the Extracellular Phosphodiesterase of the Immunotransmitter cGAMP.
19	AFDB:E2RUH1	0.358	0.826	2.575E-51	372	0.327	0.758	E2RUH1.pdb.gz	E2RUH1_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2 OS=Gallus gallus OX=9031 GN=Enpp2 PE=1 SV=1
20	PDB:5venA	0.397	0.880	1.071E-32	382	0.130	0.293	5venA.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0JZL7	0.0	762	878	0.441	0.434	B0JZL7_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 1 OS=Danio rerio OX=7955 GN=si:ch211-142e24.2 PE=1 SV=1
2	B2RBY8	0.0	748	873	0.435	0.430	B2RBY8_HUMAN cDNA, FLJ95771, highly similar to Homo sapiens ectonucleotide pyrophosphatase/phosphodiesterase 1 (ENPP1), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
3	E2RUH0	0.0	1543	859	0.834	0.838	E2RUH0_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2, long form OS=Gallus gallus OX=9031 GN=Enpp2 PE=2 SV=1
4	E2RUH1	0.0	609	372	0.327	0.758	E2RUH1_CHICK Ectonucleotide pyrophosphatase/phosphodiesterase 2 OS=Gallus gallus OX=9031 GN=Enpp2 PE=1 SV=1
5	O14638	0.0	789	875	0.438	0.432	ENPP3_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2
6	P06802	0.0	731	906	0.426	0.406	ENPP1_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Mus musculus OX=10090 GN=Enpp1 PE=1 SV=4
7	P22413	0.0	751	925	0.436	0.406	ENPP1_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Homo sapiens OX=9606 GN=ENPP1 PE=1 SV=2
8	P97675	0.0	808	875	0.445	0.439	ENPP3_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Rattus norvegicus OX=10116 GN=Enpp3 PE=1 SV=2
9	Q13822	0.0	1808	863	1.000	1.000	ENPP2_HUMAN Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Homo sapiens OX=9606 GN=ENPP2 PE=1 SV=3
10	Q64610	0.0	1702	887	0.939	0.913	ENPP2_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Rattus norvegicus OX=10116 GN=Enpp2 PE=1 SV=2
11	Q6DYE8	0.0	797	874	0.446	0.441	ENPP3_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Mus musculus OX=10090 GN=Enpp3 PE=1 SV=2
12	Q6PGY9	0.0	1240	850	0.656	0.666	Q6PGY9_DANRE Ectonucleotide pyrophosphatase/phosphodiesterase 2 OS=Danio rerio OX=7955 GN=atx PE=2 SV=1
13	Q924C3	0.0	729	906	0.425	0.405	ENPP1_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 OS=Rattus norvegicus OX=10116 GN=Enpp1 PE=1 SV=2
14	Q9R1E6	0.0	1716	862	0.941	0.942	ENPP2_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 OS=Mus musculus OX=10090 GN=Enpp2 PE=1 SV=3
15	Q9SU81	7.29e-70	240	461	0.166	0.310	Q9SU81_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29700 PE=1 SV=1
16	Q9SU83	2.14e-69	240	496	0.169	0.294	Q9SU83_ARATH Alkaline-phosphatase-like family protein OS=Arabidopsis thaliana OX=3702 GN=At4g29680 PE=1 SV=1
17	Q9Y6X5	1.17e-51	189	453	0.160	0.305	ENPP4_HUMAN Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3
18	Q9EQG7	8.62e-51	187	477	0.137	0.247	ENPP5_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Mus musculus OX=10090 GN=Enpp5 PE=1 SV=3
19	Q5EZ72	1.80e-50	186	439	0.151	0.296	ENPP7_RAT Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Rattus norvegicus OX=10116 GN=Enpp7 PE=1 SV=1
20	Q3TIW9	4.54e-50	184	439	0.152	0.298	ENPP7_MOUSE Ectonucleotide pyrophosphatase/phosphodiesterase family member 7 OS=Mus musculus OX=10090 GN=Enpp7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01223 Endonuclease_NS	1.1e-06	40.2	DNA/RNA non-specific endonuclease
2	PF01663 Phosphodiest	6.3e-76	267.9	Type I phosphodiesterase / nucleotide pyrophosphatase
3	PF01033 Somatomedin_B	8.9e-13	59.7	Somatomedin B domain
4	PF00884 Sulfatase	0.29	22.1	Sulfatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003822643.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003823506.1	0.924	Ectonucleotide pyrophosphatase/phosphodiesterase 6
2	9597.XP_003807156.1	0.903	Transmembrane protein 86B
3	9597.XP_003804988.1	0.902	Lysophospholipid acyltransferase LPCAT4
4	9597.XP_003817413.1	0.840	Glycerophosphodiester phosphodiesterase domain-containing protein 1 isoform X1
5	9597.XP_008959822.1	0.808	Glycerophosphodiester phosphodiesterase domain containing 3
6	9597.XP_008956359.1	0.733	Group 10 secretory phospholipase A2
7	9597.XP_003810923.1	0.719	Belongs to the G-protein coupled receptor 1 family.
8	9597.XP_003832441.1	0.718	Phospholipase A2
9	9597.XP_008965327.1	0.718	Phospholipase A2 group IIA
10	9597.XP_003805662.1	0.717	Cytosolic phospholipase A2 epsilon
11	9597.XP_003814460.1	0.714	Phospholipase A2 group V
12	9597.XP_003815638.1	0.689	Cytosolic phospholipase A2
13	9597.XP_008969222.1	0.676	Belongs to the G-protein coupled receptor 1 family.
14	9597.XP_003814458.1	0.675	Group IID secretory phospholipase A2 isoform X1
15	9597.XP_003805335.1	0.669	Belongs to the G-protein coupled receptor 1 family.
16	9597.XP_003827183.1	0.665	Phospholipase B1, membrane-associated isoform X1
17	9597.XP_003832415.1	0.661	Receptor for ATP that acts as a ligand-gated ion channel.
18	9597.XP_003816028.1	0.657	Group XIIB secretory phospholipase A2-like protein isoform X1
19	9597.XP_003822172.1	0.657	Enolase 1
20	9597.XP_003826977.1	0.656	Phospholipase A2 group III

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008081	1.000	phosphoric diester hydrolase activity
GO:0005509	1.000	calcium ion binding
GO:0008270	1.000	zinc ion binding
GO:0004622	0.999	lysophospholipase activity
GO:0004518	0.996	nuclease activity
GO:0004527	0.994	exonuclease activity
GO:0004528	0.869	phosphodiesterase I activity
GO:0047391	0.663	alkylglycerophosphoethanolamine phosphodiesterase activity
GO:0016818	0.436	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0016462	0.404	pyrophosphatase activity
GO:0005515	0.368	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.968	primary metabolic process
GO:0006793	0.968	phosphorus metabolic process
GO:0006796	0.957	phosphate-containing compound metabolic process
GO:0044255	0.949	cellular lipid metabolic process
GO:0006807	0.935	nitrogen compound metabolic process
GO:1901564	0.923	organonitrogen compound metabolic process
GO:0019637	0.913	organophosphate metabolic process
GO:0006644	0.900	phospholipid metabolic process
GO:0046486	0.860	glycerolipid metabolic process
GO:0046434	0.841	organophosphate catabolic process
GO:0006650	0.806	glycerophospholipid metabolic process
GO:0016042	0.798	lipid catabolic process
GO:0065007	0.779	biological regulation
GO:0046503	0.760	glycerolipid catabolic process
GO:0009395	0.760	phospholipid catabolic process
GO:0050789	0.751	regulation of biological process
GO:0046470	0.721	phosphatidylcholine metabolic process
GO:0046475	0.609	glycerophospholipid catabolic process
GO:0050794	0.474	regulation of cellular process
GO:0032501	0.425	multicellular organismal process
GO:0050896	0.380	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005886	0.942	plasma membrane
GO:0005615	0.880	extracellular space
GO:0043231	0.745	intracellular membrane-bounded organelle
GO:0005737	0.696	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	1.000	Phosphoric diester hydrolases.
RHEA:15177	0.999	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	0.999	lysophospholipase.
EC:3.1.4.1	0.869	phosphodiesterase I.
RHEA:15965	0.663	1-O-alkyl-sn-glycero-3-phosphoethanolamine + H2O = 1-O-alkyl-sn-glycero-3-phosphate + ethanolamine + H(+)
EC:3.1.4.39	0.663	alkylglycerophosphoethanolamine phosphodiesterase.
EC:3.6.1.-	0.436	In phosphorus-containing anhydrides.

[back to server]