StarFunc result for job id Q13823

User Input

>input (731 residues)
MVKPKYKGRSTINPSKASTNPDRVQGAGGQNMRDRATIRRLNMYRQKERRNSRGKIIKPL
QYQSTVASGTVARVEPNIKWFGNTRVIKQSSLQKFQEEMDTVMKDPYKVVMKQSKLPMSL
LHDRIRPHNLKVHILDTESFETTFGPKSQRKRPNLFASDMQSLIENAEMSTESYDQGKDR
DLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPHIETY
LKKEKPWKHLIFVLNKCDLVPTWATKRWVAVLSQDYPTLAFHASLTNPFGKGAFIQLLRQ
FGKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLI
DCPGVVYPSEDSETDIVLKGVVQVEKIKSPEDHIGAVLERAKPEYISKTYKIDSWENAED
FLEKLAFRTGKLLKGGEPDLQTVGKMVLNDWQRGRIPFFVKPPNAEPLVAPQLLPSSSLE
VVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINVVP
QFSGDDLVPVEVSDLEEELESFSDEEEEEQEQQRDDAEESSSEPEEENVGNDTKAVIKAL
DEKIAKYQKFLDKAKAKKFSAVRISKGLSEKIFAKPEEQRKTLEEDVDDRAPSKKGKKRK
AQREEEQEHSNKAPRALTSKERRRAVRQQRPKKVGVRYYETHNVKNRNRNKKKTNDSEGQ
KHKRKKFRQKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13823	1.000	1.000	0.000	731	1.000	1.000	Q13823.pdb.gz	NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1
2	AFDB:Q7SZQ9	0.698	0.702	2.182E-86	727	0.662	0.666	Q7SZQ9.pdb.gz	Q7SZQ9_DANRE Nucleolar GTP-binding protein 2 OS=Danio rerio OX=7955 GN=zgc:65800 PE=1 SV=1
3	AFDB:Q9C923	0.612	0.770	1.185E-62	576	0.380	0.483	Q9C923.pdb.gz	NUG2_ARATH Nuclear/nucleolar GTPase 2 OS=Arabidopsis thaliana OX=3702 GN=NUG2 PE=1 SV=1
4	AFDB:Q57TY2	0.575	0.696	1.468E-57	601	0.358	0.436	Q57TY2.pdb.gz	Q57TY2_TRYB2 Nucleolar GTP-binding protein 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.330 PE=3 SV=1
5	AFDB:O14236	0.580	0.787	5.999E-57	537	0.334	0.454	O14236.pdb.gz	NOG2_SCHPO Nucleolar GTP-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nog2 PE=1 SV=1
6	AFDB:G0SBX1	0.573	0.666	1.828E-56	627	0.353	0.411	G0SBX1.pdb.gz	G0SBX1_CHATD Nucleolar GTP-binding protein 2 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0055100 PE=3 SV=1
7	PDB:7btbm	0.565	0.863	5.334E-47	469	0.345	0.537	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
8	PDB:6n8jm	0.468	0.885	8.459E-39	378	0.298	0.577	6n8jm.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
9	AFDB:A0A0R4IUN4	0.335	0.912	5.855E-33	261	0.308	0.862	A0A0R4IUN4.pdb.gz
10	AFDB:Q9M8Z5	0.366	0.455	1.099E-31	582	0.219	0.275	Q9M8Z5.pdb.gz	NSN1_ARATH Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana OX=3702 GN=NSN1 PE=1 SV=1
11	AFDB:Q21086	0.353	0.461	2.885E-29	556	0.190	0.250	Q21086.pdb.gz	GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans OX=6239 GN=nst-1 PE=3 SV=1
12	AFDB:Q386P6	0.337	0.496	1.507E-25	486	0.161	0.243	Q386P6.pdb.gz	Q386P6_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0240 PE=4 SV=1
13	PDB:7of1m	0.240	0.754	9.070E-21	229	0.170	0.541	7of1m.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
14	PDB:5t62W	0.313	0.716	5.740E-18	306	0.103	0.245	5t62W.pdb.gz	Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis.
15	PDB:6n8nW	0.323	0.593	9.999E-16	377	0.123	0.239	6n8nW.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
16	PDB:1pujA	0.297	0.765	1.174E-14	261	0.085	0.238	1pujA.pdb.gz	Structure of the YlqF GTPase from B. subtilis
17	PDB:6qtzo	0.302	0.647	1.574E-14	325	0.124	0.280	6qtzo.pdb.gz	Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
18	PDB:7pd3z	0.312	0.696	1.416E-11	311	0.089	0.209	7pd3z.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
19	PDB:7o9kC	0.258	0.662	3.777E-10	255	0.082	0.235	7o9kC.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
20	PDB:6yxyEM	0.249	0.496	1.115E-7	330	0.079	0.176	6yxyEM.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13823	0.0	1509	731	1.000	1.000	NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1
2	Q5T0F3	0.0	1509	731	1.000	1.000	Q5T0F3_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=2 SV=1
3	Q7JXU4	0.0	633	674	0.486	0.527	Q7JXU4_DROME Nucleolar GTP-binding protein 2 OS=Drosophila melanogaster OX=7227 GN=Ns2 PE=1 SV=1
4	Q7SZQ9	0.0	927	727	0.651	0.655	Q7SZQ9_DANRE Nucleolar GTP-binding protein 2 OS=Danio rerio OX=7955 GN=zgc:65800 PE=1 SV=1
5	Q9C923	1.66e-176	519	576	0.354	0.450	NUG2_ARATH Nuclear/nucleolar GTPase 2 OS=Arabidopsis thaliana OX=3702 GN=NUG2 PE=1 SV=1
6	P53742	2.77e-172	504	486	0.339	0.510	NOG2_YEAST Nucleolar GTP-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOG2 PE=1 SV=1
7	O14236	5.10e-164	485	537	0.341	0.464	NOG2_SCHPO Nucleolar GTP-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nog2 PE=1 SV=1
8	Q57TY2	9.92e-156	466	601	0.334	0.406	Q57TY2_TRYB2 Nucleolar GTP-binding protein 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.330 PE=3 SV=1
9	G0SBX1	5.11e-152	457	627	0.324	0.378	G0SBX1_CHATD Nucleolar GTP-binding protein 2 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0055100 PE=3 SV=1
10	Q9M8Z5	1.01e-58	211	582	0.156	0.196	NSN1_ARATH Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana OX=3702 GN=NSN1 PE=1 SV=1
11	Q7SZX9	1.73e-55	201	565	0.140	0.181	Q7SZX9_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio OX=7955 GN=SI:zK13A21.8 PE=1 SV=1
12	Q8MT06	1.33e-52	194	581	0.153	0.193	GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster OX=7227 GN=Ns1 PE=1 SV=2
13	Q21086	1.34e-51	190	556	0.153	0.201	GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans OX=6239 GN=nst-1 PE=3 SV=1
14	Q9NVN8	7.32e-51	189	582	0.152	0.191	GNL3L_HUMAN Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens OX=9606 GN=GNL3L PE=1 SV=1
15	Q8CI11	5.24e-46	174	538	0.138	0.188	GNL3_MOUSE Guanine nucleotide-binding protein-like 3 OS=Mus musculus OX=10090 GN=Gnl3 PE=1 SV=2
16	Q6DRP2	1.40e-45	173	561	0.118	0.153	GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio OX=7955 GN=gnl3 PE=2 SV=1
17	Q9BVP2	1.55e-44	170	549	0.134	0.179	GNL3_HUMAN Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3 PE=1 SV=2
18	Q386P6	4.24e-40	156	486	0.144	0.216	Q386P6_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0240 PE=4 SV=1
19	Q811S9	2.49e-39	155	538	0.127	0.173	GNL3_RAT Guanine nucleotide-binding protein-like 3 OS=Rattus norvegicus OX=10116 GN=Gnl3 PE=1 SV=1
20	P40010	2.54e-38	152	520	0.146	0.206	NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUG1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	96	13.9	ADP-ribosylation factor family
2	PF02421 FeoB_N	0.035	25.1	Ferrous iron transport protein B
3	PF01926 MMR_HSR1	5.3e-12	57.2	50S ribosome-binding GTPase
4	PF08153 NGP1NT	2.3e-45	165.4	NGP1NT (NUC091) domain
5	PF03193 RsgA_GTPase	2.2	19.6	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362153

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260443	0.999	Probable ribosome biogenesis protein RLP24
2	9606.ENSP00000354040	0.999	Nucleolar GTP-binding protein 1
3	9606.ENSP00000402338	0.999	Ribosome production factor 2 homolog
4	9606.ENSP00000483484	0.999	Ribosome biogenesis protein NSA2 homolog
5	9606.ENSP00000419004	0.997	60S ribosomal export protein NMD3
6	9606.ENSP00000346725	0.996	Pescadillo homolog
7	9606.ENSP00000364320	0.995	mRNA turnover protein 4 homolog
8	9606.ENSP00000395772	0.995	Guanine nucleotide-binding protein-like 3
9	9606.ENSP00000363574	0.994	Eukaryotic translation initiation factor 6
10	9606.ENSP00000338573	0.993	Guanine nucleotide-binding protein-like 3-like protein
11	9606.ENSP00000363384	0.991	Zinc finger protein 593
12	9606.ENSP00000364037	0.991	Testis-expressed protein 10
13	9606.ENSP00000476117	0.991	WD repeat-containing protein 18
14	9606.ENSP00000246802	0.990	Ribosome biogenesis protein NOP53
15	9606.ENSP00000413572	0.989	Notchless protein homolog 1
16	9606.ENSP00000348596	0.987	Protein SDA1 homolog
17	9606.ENSP00000418082	0.987	Ribosomal protein L37a
18	9606.ENSP00000285814	0.986	Nucleolar protein interacting with the FHA domain of MKI67
19	9606.ENSP00000389103	0.984	60S ribosomal protein L23a
20	9606.ENSP00000261015	0.983	Ribosome biogenesis protein WDR12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.943	protein binding
GO:0003824	0.922	catalytic activity
GO:0016787	0.370	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043010	0.996	camera-type eye development
GO:0000466	0.996	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463	0.996	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0007096	0.995	regulation of exit from mitosis
GO:0000479	0.995	endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0060041	0.925	retina development in camera-type eye
GO:0003407	0.902	neural retina development
GO:0045664	0.844	regulation of neuron differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0016020	0.963	membrane
GO:0005654	0.950	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.370	Hydrolases.

[back to server]