StarFunc result for job id Q13825

User Input

>input (339 residues)
MAAAVAAAPGALGSLHAGGARLVAACSAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGG
PAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKS
DKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAID
GLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSA
RVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVD
LVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13825	1.000	1.000	1.893E-64	339	1.000	1.000	Q13825.pdb.gz	AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=AUH PE=1 SV=1
2	AFDB:Q9JLZ3	0.816	0.881	1.936E-57	314	0.867	0.936	Q9JLZ3.pdb.gz	AUHM_MOUSE Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Auh PE=1 SV=1
3	AFDB:A1Z934	0.783	0.887	4.139E-41	299	0.475	0.538	A1Z934.pdb.gz	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
4	AFDB:F4JML5	0.758	0.853	6.857E-38	301	0.378	0.425	F4JML5.pdb.gz	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
5	AFDB:A4YI89	0.727	0.944	5.682E-30	259	0.289	0.378	A4YI89.pdb.gz	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
6	PDB:5zaiC	0.721	0.936	6.354E-28	259	0.289	0.378	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
7	AFDB:P34559	0.706	0.825	1.566E-27	288	0.289	0.340	P34559.pdb.gz	ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ech-6 PE=3 SV=1
8	AFDB:C8V3K8	0.719	0.836	9.413E-27	289	0.265	0.311	C8V3K8.pdb.gz	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
9	AFDB:Q7JR58	0.713	0.814	1.817E-26	295	0.292	0.336	Q7JR58.pdb.gz	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
10	PDB:3h81A	0.699	0.913	2.295E-26	256	0.271	0.359	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
11	AFDB:P30084	0.711	0.825	3.303E-26	290	0.263	0.307	P30084.pdb.gz	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4
12	AFDB:P14604	0.709	0.823	3.723E-26	290	0.268	0.314	P14604.pdb.gz	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
13	PDB:4fzwB	0.711	0.931	1.224E-25	256	0.274	0.363	4fzwB.pdb.gz
14	PDB:2hw5C	0.710	0.913	6.147E-25	260	0.242	0.315	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
15	PDB:1dubA	0.703	0.904	1.259E-24	260	0.245	0.319	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
16	PDB:4fzwD	0.689	0.920	2.087E-21	250	0.233	0.316	4fzwD.pdb.gz
17	PDB:6wyiA	0.651	0.921	8.760E-21	237	0.224	0.321	6wyiA.pdb.gz
18	PDB:7oeqA	0.680	0.879	9.300E-21	259	0.206	0.270	7oeqA.pdb.gz
19	PDB:4i42A	0.576	0.675	2.728E-20	285	0.221	0.263	4i42A.pdb.gz	Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme A synthase from the crotonase fold superfamily
20	PDB:4izcB	0.670	0.842	3.785E-19	266	0.209	0.267	4izcB.pdb.gz	Crystal Structure of DmdD, a Crotonase Superfamily Enzyme That Catalyzes the Hydration and Hydrolysis of Methylthioacryloyl-CoA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13825	0.0	672	339	1.000	1.000	AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=AUH PE=1 SV=1
2	Q9JLZ3	0.0	524	314	0.841	0.908	AUHM_MOUSE Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Auh PE=1 SV=1
3	A1Z934	3.71e-109	322	299	0.460	0.522	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
4	F4JML5	4.53e-80	248	301	0.378	0.425	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
5	A4YI89	8.52e-51	171	259	0.301	0.394	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
6	P34559	6.36e-44	154	288	0.271	0.319	ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ech-6 PE=3 SV=1
7	P9WNN9	1.76e-43	152	257	0.274	0.362	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
8	P76082	3.95e-43	151	255	0.274	0.365	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
9	Q7JR58	5.28e-41	147	295	0.280	0.322	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
10	Q8BH95	1.01e-38	140	290	0.251	0.293	ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Echs1 PE=1 SV=1
11	P14604	5.81e-38	139	290	0.248	0.290	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
12	P30084	4.10e-37	136	290	0.242	0.283	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4
13	C8V3K8	8.28e-34	127	289	0.257	0.301	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
14	O53561	1.21e-31	121	266	0.257	0.327	ECH19_MYCTU Enoyl-CoA hydratase EchA19 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA19 PE=1 SV=2
15	G4V4T7	3.74e-28	112	265	0.236	0.302	DPGD_AMYOR Enoyl-CoA-hydratase OS=Amycolatopsis orientalis OX=31958 GN=dpgD PE=1 SV=1
16	P9WNN3	8.95e-28	111	261	0.233	0.303	ECH17_MYCTU Probable enoyl-CoA hydratase EchA17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA17 PE=1 SV=2
17	P31551	1.30e-26	108	261	0.230	0.299	CAID_ECOLI Carnitinyl-CoA dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=caiD PE=1 SV=4
18	P28793	1.53e-26	112	715	0.227	0.108	FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi OX=296 GN=fadB PE=1 SV=1
19	Q6NL24	1.80e-25	105	265	0.236	0.302	ECH1P_ARATH Probable enoyl-CoA hydratase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ECHIA PE=1 SV=1
20	A7YT47	5.65e-24	105	761	0.177	0.079	A7YT47_DANRE enoyl-CoA hydratase OS=Danio rerio OX=7955 GN=hadha PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00378 ECH_1	7e-54	194.4	Enoyl-CoA hydratase/isomerase
2	PF16113 ECH_2	2.1e-24	98.3	Enoyl-CoA hydratase/isomerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364883

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363614	0.969	Hydroxymethylglutaryl-CoA lyase, mitochondrial
2	9606.ENSP00000343657	0.960	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial
3	9606.ENSP00000381654	0.955	3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic
4	9606.ENSP00000265594	0.944	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial
5	9606.ENSP00000358414	0.936	Hydroxymethylglutaryl-CoA synthase, mitochondrial
6	9606.ENSP00000322706	0.930	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
7	9606.ENSP00000474560	0.864	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
8	9606.ENSP00000372005	0.820	Mitochondrial import inner membrane translocase subunit TIM14
9	9606.ENSP00000319817	0.772	Optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)
10	9606.ENSP00000312599	0.744	Transmembrane protein 70, mitochondrial
11	9606.ENSP00000332340	0.741	Probable ATP-dependent RNA helicase DDX28
12	9606.ENSP00000469981	0.740	Tafazzin
13	9606.ENSP00000418397	0.739	Isovaleryl-CoA dehydrogenase, mitochondrial
14	9606.ENSP00000366939	0.733	Mitochondrial genome maintenance exonuclease 1
15	9606.ENSP00000427567	0.718	Microtubule-associated formin which regulates both actin and microtubule dynamics. Induces microtubule acetylation and stabilization and actin stress fiber formation . Regulates Golgi ribbon formation . Required for normal cilia assembly. Early in cilia assembly, may assist in the maturation and positioning of the centrosome/basal body, and once cilia assembly has initiated, may also promote cilia elongation by inhibiting disassembly
16	9606.ENSP00000442563	0.707	DNA polymerase subunit gamma-2, mitochondrial
17	9606.ENSP00000343742	0.706	BRO1 domain-containing protein BROX
18	9606.ENSP00000355471	0.697	Dimethyladenosine transferase 2, mitochondrial
19	9606.ENSP00000265395	0.690	3-hydroxyisobutyrate dehydrogenase, mitochondrial
20	9606.ENSP00000340900	0.687	Transport and Golgi organization protein 1 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004300	1.000	enoyl-CoA hydratase activity
GO:0003723	1.000	RNA binding
GO:0005515	0.928	protein binding
GO:0003729	0.763	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044281	0.980	small molecule metabolic process
GO:0019752	0.972	carboxylic acid metabolic process
GO:0009056	0.927	catabolic process
GO:0046395	0.906	carboxylic acid catabolic process
GO:0006807	0.891	nitrogen compound metabolic process
GO:0006629	0.865	lipid metabolic process
GO:0006631	0.832	fatty acid metabolic process
GO:1901564	0.516	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0070013	0.996	intracellular organelle lumen
GO:0005759	0.951	mitochondrial matrix
GO:0016020	0.507	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16105	1.000	a (3S)-3-hydroxyacyl-CoA = a (2E)-enoyl-CoA + H2O
EC:4.2.1.17	1.000	enoyl-CoA hydratase.

[back to server]