StarFunc result for job id Q13835

User Input

>input (747 residues)
MNHSPLKTALAYECFQDQDNSTLALPSDQKMKTGTSGRQRVQEQVMMTVKRQKSKSSQSS
TLSHSNRGSMYDGLADNYNYGTTSRSSYYSKFQAGNGSWGYPIYNGTLKREPDNRRFSSY
SQMENWSRHYPRGSCNTTGAGSDICFMQKIKASRSEPDLYCDPRGTLRKGTLGSKGQKTT
QNRYSFYSTCSGQKAIKKCPVRPPSCASKQDPVYIPPISCNKDLSFGHSRASSKICSEDI
ECSGLTIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPN
QNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSST
DELKEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRKRLGMRELL
ALVPQRATSSRVNLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLH
NLSYRLDAEVPTRYRQLEYNARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGS
GWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQI
ARLLQSGNSDVVRSGASLLSNMSRHPLLHRVMGNQVFPEVTRLLTSHTGNTSNSEDILSS
ACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGV
LRQQGFDRNMLGTLAGANSLRNFTSRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13835	1.000	1.000	1.187E-86	747	1.000	1.000	Q13835.pdb.gz	PKP1_HUMAN Plakophilin-1 OS=Homo sapiens OX=9606 GN=PKP1 PE=1 SV=2
2	AFDB:P97350	0.708	0.725	8.477E-72	728	0.921	0.945	P97350.pdb.gz	PKP1_MOUSE Plakophilin-1 OS=Mus musculus OX=10090 GN=Pkp1 PE=1 SV=1
3	PDB:2z6gA	0.306	0.387	5.125E-9	550	0.112	0.153	2z6gA.pdb.gz
4	AFDB:Q8T2I8	0.234	0.158	9.416E-9	1167	0.137	0.087	Q8T2I8.pdb.gz	SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum OX=44689 GN=sepA PE=2 SV=1
5	PDB:4r0zA	0.348	0.435	2.186E-8	557	0.096	0.129	4r0zA.pdb.gz
6	PDB:6kbnC	0.422	0.606	3.082E-8	504	0.116	0.173	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
7	PDB:1wa5B	0.413	0.629	5.897E-8	466	0.092	0.148	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
8	PDB:5tbkA	0.413	0.700	9.686E-8	417	0.102	0.182	5tbkA.pdb.gz
9	PDB:4tnmA	0.316	0.511	3.977E-7	407	0.091	0.167	4tnmA.pdb.gz
10	PDB:7rroH7	0.349	0.428	7.906E-7	580	0.096	0.124	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
11	PDB:7nscE	0.274	0.313	9.210E-7	615	0.106	0.128	7nscE.pdb.gz
12	PDB:3tpoA	0.422	0.684	1.073E-6	438	0.080	0.137	3tpoA.pdb.gz
13	AFDB:Q6A070	0.183	0.092	4.566E-6	1776	0.157	0.066	Q6A070.pdb.gz	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3
14	AFDB:Q9ESJ4	0.274	0.283	4.928E-6	714	0.104	0.109	Q9ESJ4.pdb.gz	SPN90_MOUSE NCK-interacting protein with SH3 domain OS=Mus musculus OX=10090 GN=Nckipsd PE=1 SV=2
15	AFDB:Q55FT4	0.278	0.119	1.141E-5	2247	0.134	0.045	Q55FT4.pdb.gz	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
16	PDB:6xu2A	0.279	0.212	3.461E-5	1091	0.098	0.067	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
17	AFDB:Q9Y4F4	0.172	0.086	5.671E-5	1720	0.161	0.070	Q9Y4F4.pdb.gz	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
18	AFDB:Q9C5E7	0.131	0.118	4.127E-4	861	0.119	0.103	Q9C5E7.pdb.gz	PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APUM6 PE=1 SV=1
19	AFDB:P36168	0.093	0.070	5.602E-4	1195	0.118	0.074	P36168.pdb.gz	ESL2_YEAST EST/SMG-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESL2 PE=1 SV=1
20	AFDB:Q6ZS17	0.135	0.093	5.602E-4	1223	0.151	0.092	Q6ZS17.pdb.gz	RIPR1_HUMAN Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97350	0.0	1405	728	0.924	0.948	PKP1_MOUSE Plakophilin-1 OS=Mus musculus OX=10090 GN=Pkp1 PE=1 SV=1
2	Q13835	0.0	1553	747	1.000	1.000	PKP1_HUMAN Plakophilin-1 OS=Homo sapiens OX=9606 GN=PKP1 PE=1 SV=2
3	Q9CQ73	2.07e-104	339	795	0.265	0.249	PKP2_MOUSE Plakophilin-2 OS=Mus musculus OX=10090 GN=Pkp2 PE=1 SV=1
4	F1M7L9	3.77e-98	323	814	0.265	0.243	PKP2_RAT Plakophilin-2 OS=Rattus norvegicus OX=10116 GN=Pkp2 PE=1 SV=4
5	Q99959	5.13e-98	325	881	0.266	0.226	PKP2_HUMAN Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2
6	B0BF33	1.96e-87	295	815	0.236	0.216	PKP2_DANRE Plakophilin-2 OS=Danio rerio OX=7955 GN=pkp2 PE=2 SV=1
7	Q68FH0	8.90e-73	259	1190	0.229	0.144	PKP4_MOUSE Plakophilin-4 OS=Mus musculus OX=10090 GN=Pkp4 PE=1 SV=1
8	Q99569	2.15e-71	255	1192	0.228	0.143	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
9	Q9Y446	3.13e-71	250	797	0.233	0.218	PKP3_HUMAN Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1
10	Q9QY23	1.44e-70	248	797	0.222	0.208	PKP3_MOUSE Plakophilin-3 OS=Mus musculus OX=10090 GN=Pkp3 PE=1 SV=2
11	Q9UQB3	3.84e-68	246	1225	0.232	0.141	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
12	P98203	5.62e-67	241	962	0.228	0.177	ARVC_MOUSE Splicing regulator ARVCF OS=Mus musculus OX=10090 GN=Arvcf PE=1 SV=2
13	B0V2S9	1.00e-65	239	1210	0.222	0.137	B0V2S9_DANRE Catenin (cadherin-associated protein), delta 2b OS=Danio rerio OX=7955 GN=ctnnd2 PE=1 SV=1
14	O00192	1.12e-65	237	962	0.224	0.174	ARVC_HUMAN Splicing regulator ARVCF OS=Homo sapiens OX=9606 GN=ARVCF PE=1 SV=1
15	Q562C0	1.18e-64	220	343	0.167	0.364	Q562C0_RAT Pkp2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Pkp2 PE=2 SV=1
16	O35927	2.26e-63	232	1247	0.226	0.136	CTND2_MOUSE Catenin delta-2 OS=Mus musculus OX=10090 GN=Ctnnd2 PE=1 SV=1
17	A0A8I5ZVG2	7.99e-60	219	870	0.206	0.177	A0A8I5ZVG2_RAT Catenin delta 1 OS=Rattus norvegicus OX=10116 GN=Ctnnd1 PE=1 SV=1
18	A0A669KB05	8.67e-60	219	915	0.209	0.170	A0A669KB05_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1
19	P30999	1.19e-59	219	938	0.209	0.166	CTND1_MOUSE Catenin delta-1 OS=Mus musculus OX=10090 GN=Ctnnd1 PE=1 SV=2
20	C9JZR2	1.24e-59	219	938	0.209	0.166	C9JZR2_HUMAN Catenin delta 1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00514 Arm	9.3e-25	97.1	Armadillo/beta-catenin-like repeat
2	PF04826 Arm_2	77	14.2	Armadillo-like
3	PF02985 HEAT	2e+02	13.7	HEAT repeat
4	PF13646 HEAT_2	35	16.2	HEAT repeats
5	PF13513 HEAT_EZ	0.0026	29.6	HEAT-like repeat
6	PF11698 V-ATPase_H_C	6.5	18.3	V-ATPase subunit H

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263946

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257192	0.993	Desmoglein-1
2	9606.ENSP00000369129	0.984	Desmoplakin
3	9606.ENSP00000257189	0.970	Desmoglein-3
4	9606.ENSP00000353608	0.948	Desmocollin-3
5	9606.ENSP00000257198	0.941	Desmocollin-1
6	9606.ENSP00000261590	0.935	Desmoglein-2
7	9606.ENSP00000352785	0.932	Desmoglein-4
8	9606.ENSP00000280904	0.914	Desmocollin-2
9	9606.ENSP00000377508	0.905	Junction plakoglobin
10	9606.ENSP00000311032	0.902	Caspase-3
11	9606.ENSP00000331678	0.836	Plakophilin-3
12	9606.ENSP00000397157	0.820	P53 apoptosis effector related to PMP-22
13	9606.ENSP00000167586	0.790	Keratin, type I cytoskeletal 14
14	9606.ENSP00000293831	0.778	Eukaryotic initiation factor 4A-I
15	9606.ENSP00000252242	0.749	Keratin, type II cytoskeletal 5
16	9606.ENSP00000359506	0.736	Synaptic functional regulator FMR1
17	9606.ENSP00000365198	0.726	Kazrin
18	9606.ENSP00000443985	0.720	Cytoplasmic polyadenylation element-binding protein 2
19	9606.ENSP00000357789	0.706	Filaggrin
20	9606.ENSP00000449404	0.705	Keratin, type II cytoskeletal 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005521	1.000	lamin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0031323	0.964	regulation of cellular metabolic process
GO:0010468	0.963	regulation of gene expression
GO:0048523	0.952	negative regulation of cellular process
GO:0048518	0.945	positive regulation of biological process
GO:0045103	0.925	intermediate filament-based process
GO:0009893	0.923	positive regulation of metabolic process
GO:1903311	0.922	regulation of mRNA metabolic process
GO:0031330	0.913	negative regulation of cellular catabolic process
GO:0010604	0.906	positive regulation of macromolecule metabolic process
GO:0016043	0.900	cellular component organization
GO:0010605	0.827	negative regulation of macromolecule metabolic process
GO:0045104	0.817	intermediate filament cytoskeleton organization
GO:0061013	0.803	regulation of mRNA catabolic process
GO:0051172	0.799	negative regulation of nitrogen compound metabolic process
GO:1902369	0.787	negative regulation of RNA catabolic process
GO:1903312	0.775	negative regulation of mRNA metabolic process
GO:1902373	0.720	negative regulation of mRNA catabolic process
GO:0045109	0.701	intermediate filament organization
GO:0022607	0.545	cellular component assembly
GO:0032502	0.465	developmental process
GO:0048856	0.461	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005886	0.998	plasma membrane
GO:0005654	0.991	nucleoplasm
GO:0001533	0.985	cornified envelope
GO:0005737	0.982	cytoplasm
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005829	0.949	cytosol
GO:0030054	0.934	cell junction
GO:0012505	0.931	endomembrane system
GO:0070161	0.901	anchoring junction
GO:0005911	0.893	cell-cell junction
GO:0031982	0.884	vesicle
GO:0005856	0.867	cytoskeleton
GO:0032991	0.836	protein-containing complex
GO:0099080	0.778	supramolecular complex
GO:0031090	0.498	organelle membrane
GO:0098588	0.459	bounding membrane of organelle
GO:0030141	0.404	secretory granule
GO:0101002	0.392	ficolin-1-rich granule
GO:0005882	0.380	intermediate filament
GO:0030659	0.357	cytoplasmic vesicle membrane
GO:0030057	0.316	desmosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]