StarFunc result for job id Q13873

User Input

>input (1038 residues)
MTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRK
QGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRC
TDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETNLHTTNVAQSIGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEATGQ
QDFTQTANGQACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSN
LKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVT
HRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLDGSSIQIGEST
QDGKSGSGEKIKKRVKTPYSLKRWRPSTWVISTESLDCEVNNNGSNRAVHSKSSTAVYLA
EGGTATTMVSKDIGMNCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0V0H4	0.427	0.414	0.000	1071	0.680	0.659	B0V0H4.pdb.gz
2	AFDB:O35607	0.451	0.451	0.000	1038	0.966	0.966	O35607.pdb.gz	BMPR2_MOUSE Bone morphogenetic protein receptor type-2 OS=Mus musculus OX=10090 GN=Bmpr2 PE=1 SV=1
3	AFDB:O42124	0.399	0.401	0.000	1031	0.884	0.890	O42124.pdb.gz	O42124_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BRK-3 PE=2 SV=1
4	AFDB:P38990	0.224	0.205	1.131E-17	1142	0.172	0.157	P38990.pdb.gz	SAK1_YEAST SNF1-activating kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAK1 PE=1 SV=1
5	AFDB:P09208	0.225	0.113	7.716E-17	2144	0.160	0.077	P09208.pdb.gz	INSR_DROME Insulin-like receptor OS=Drosophila melanogaster OX=7227 GN=InR PE=1 SV=3
6	AFDB:M9PBJ7	0.217	0.188	2.312E-16	1213	0.149	0.128	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1
7	AFDB:Q9JM52	0.223	0.179	2.581E-16	1308	0.150	0.119	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
8	AFDB:Q9R0G8	0.225	0.165	2.581E-16	1455	0.136	0.097	Q9R0G8.pdb.gz	NRK_MOUSE Nik-related protein kinase OS=Mus musculus OX=10090 GN=Nrk PE=1 SV=2
9	AFDB:P83741	0.215	0.099	2.726E-16	2377	0.174	0.076	P83741.pdb.gz	WNK1_MOUSE Serine/threonine-protein kinase WNK1 OS=Mus musculus OX=10090 GN=Wnk1 PE=1 SV=2
10	AFDB:Q9H4A3	0.214	0.099	2.726E-16	2382	0.172	0.075	Q9H4A3.pdb.gz	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
11	PDB:4eomC	0.215	0.743	6.163E-15	276	0.066	0.250	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
12	PDB:1k9aB	0.214	0.485	9.049E-15	441	0.069	0.163	1k9aB.pdb.gz
13	PDB:5u6yA	0.216	0.463	9.049E-15	459	0.067	0.153	5u6yA.pdb.gz
14	PDB:1unlA	0.203	0.668	1.127E-14	292	0.066	0.236	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:4krcA	0.207	0.662	1.191E-14	297	0.072	0.253	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:8dksA	0.209	0.698	1.951E-14	283	0.069	0.254	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:2qkwB	0.216	0.705	2.712E-14	292	0.065	0.229	2qkwB.pdb.gz
18	PDB:3c4wB	0.215	0.411	2.712E-14	519	0.069	0.139	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
19	PDB:3nynA	0.226	0.407	4.444E-14	554	0.060	0.112	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
20	PDB:4zhxA	0.217	0.517	5.534E-14	409	0.064	0.161	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AM39	0.0	2007	1052	0.961	0.949	A0A8I6AM39_RAT receptor protein serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bmpr2 PE=3 SV=1
2	F1LQC5	0.0	2008	1037	0.960	0.960	F1LQC5_RAT receptor protein serine/threonine kinase OS=Rattus norvegicus OX=10116 GN=Bmpr2 PE=1 SV=3
3	O35607	0.0	2105	1038	0.966	0.966	BMPR2_MOUSE Bone morphogenetic protein receptor type-2 OS=Mus musculus OX=10090 GN=Bmpr2 PE=1 SV=1
4	O42124	0.0	1830	1031	0.884	0.890	O42124_CHICK receptor protein serine/threonine kinase OS=Gallus gallus OX=9031 GN=BRK-3 PE=2 SV=1
5	Q13873	0.0	2167	1038	1.000	1.000	BMPR2_HUMAN Bone morphogenetic protein receptor type-2 OS=Homo sapiens OX=9606 GN=BMPR2 PE=1 SV=2
6	Q288P2	0.0	1232	1071	0.687	0.666	Q288P2_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=bmpr2b PE=2 SV=1
7	Q288P3	0.0	939	1003	0.511	0.528	Q288P3_DANRE receptor protein serine/threonine kinase OS=Danio rerio OX=7955 GN=bmpr2a PE=2 SV=1
8	Q9NGX8	4.62e-111	368	903	0.188	0.216	Q9NGX8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=wit PE=2 SV=2
9	Q95V83	1.18e-110	367	903	0.187	0.215	Q95V83_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=wit PE=3 SV=1
10	Q9VZI9	1.34e-110	366	903	0.187	0.215	Q9VZI9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=wit PE=2 SV=1
11	M9PE88	1.38e-110	367	913	0.187	0.212	M9PE88_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=wit PE=3 SV=1
12	Q90670	2.58e-91	303	512	0.166	0.336	AVR2B_CHICK Activin receptor type-2B OS=Gallus gallus OX=9031 GN=ACVR2B PE=2 SV=1
13	Q9YGU4	4.26e-91	302	509	0.168	0.342	Q9YGU4_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=ActrIIB PE=1 SV=1
14	Q90669	1.30e-90	301	513	0.166	0.335	AVR2A_CHICK Activin receptor type-2A OS=Gallus gallus OX=9031 GN=ACVR2A PE=2 SV=1
15	P38445	3.52e-89	297	513	0.172	0.349	AVR2B_RAT Activin receptor type-2B OS=Rattus norvegicus OX=10116 GN=Acvr2b PE=1 SV=3
16	Q13705	1.43e-87	293	512	0.172	0.350	AVR2B_HUMAN Activin receptor type-2B OS=Homo sapiens OX=9606 GN=ACVR2B PE=1 SV=3
17	Q66T47	2.35e-87	292	512	0.171	0.348	AVR2B_PIG Activin receptor type-2B OS=Sus scrofa OX=9823 GN=ACVR2B PE=2 SV=1
18	F1QG01	1.26e-86	290	514	0.165	0.333	F1QG01_DANRE Serine/threonine-protein kinase receptor OS=Danio rerio OX=7955 GN=actr2a PE=3 SV=1
19	Q24229	9.77e-85	285	516	0.162	0.326	Q24229_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=2 SV=1
20	Q24468	1.10e-84	285	516	0.162	0.326	Q24468_DROME Serine/threonine-protein kinase receptor OS=Drosophila melanogaster OX=7227 GN=put PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2.1e+02	12.4	ABC1 atypical kinase-like domain
2	PF01064 Activin_recp	1.7e-10	53.0	Activin types I and II receptor domain
3	PF01636 APH	19	16.6	Phosphotransferase enzyme family
4	PF16492 Cadherin_C_2	3.2e+02	13.4	Cadherin cytoplasmic C-terminal
5	PF00069 Pkinase	7.1e-29	112.6	Protein kinase domain
6	PF07714 PK_Tyr_Ser-Thr	3.1e-26	103.8	Protein tyrosine and serine/threonine kinase
7	PF19974 TCAD9	20	15.7	Ternary complex associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245451	0.999	Bone morphogenetic protein 4
2	9606.ENSP00000368104	0.999	Bone morphogenetic protein 2
3	9606.ENSP00000379204	0.999	Bone morphogenetic protein 7
4	9606.ENSP00000463051	0.999	Growth/differentiation factor 2
5	9606.ENSP00000283147	0.993	Bone morphogenetic protein 6
6	9606.ENSP00000363492	0.992	Growth/differentiation factor 5
7	9606.ENSP00000367942	0.991	Growth/differentiation factor 9
8	9606.ENSP00000295379	0.987	Bone morphogenetic protein 10
9	9606.ENSP00000263640	0.985	Activin receptor type-1
10	9606.ENSP00000288840	0.984	Mothers against decapentaplegic homolog 6
11	9606.ENSP00000256759	0.982	Follistatin
12	9606.ENSP00000441954	0.982	Mothers against decapentaplegic homolog 5
13	9606.ENSP00000369154	0.980	Mothers against decapentaplegic homolog 9
14	9606.ENSP00000362299	0.977	Endoglin
15	9606.ENSP00000341551	0.975	Mothers against decapentaplegic homolog 4
16	9606.ENSP00000262158	0.972	Mothers against decapentaplegic homolog 7
17	9606.ENSP00000364683	0.971	BMP and activin membrane-bound inhibitor homolog
18	9606.ENSP00000359866	0.969	Bone morphogenetic protein 5
19	9606.ENSP00000339191	0.968	Caveolin-1
20	9606.ENSP00000328181	0.966	Noggin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004675	0.999	transmembrane receptor protein serine/threonine kinase activity
GO:0019955	0.998	cytokine binding
GO:0036122	0.991	BMP binding
GO:0019838	0.686	growth factor binding
GO:0098772	0.525	molecular function regulator activity
GO:0005024	0.439	transforming growth factor beta receptor activity
GO:0140677	0.391	molecular function activator activity
GO:0043539	0.338	protein serine/threonine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0048518	0.994	positive regulation of biological process
GO:0032501	0.989	multicellular organismal process
GO:0051716	0.988	cellular response to stimulus
GO:0023052	0.987	signaling
GO:0048856	0.987	anatomical structure development
GO:0050794	0.986	regulation of cellular process
GO:0070848	0.985	response to growth factor
GO:0048731	0.982	system development
GO:0007178	0.981	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071363	0.976	cellular response to growth factor stimulus
GO:0048513	0.974	animal organ development
GO:0051239	0.973	regulation of multicellular organismal process
GO:0050793	0.922	regulation of developmental process
GO:0051240	0.873	positive regulation of multicellular organismal process
GO:0019222	0.863	regulation of metabolic process
GO:0009653	0.860	anatomical structure morphogenesis
GO:0051094	0.859	positive regulation of developmental process
GO:0080090	0.848	regulation of primary metabolic process
GO:0060255	0.848	regulation of macromolecule metabolic process
GO:2000026	0.845	regulation of multicellular organismal development
GO:0051171	0.843	regulation of nitrogen compound metabolic process
GO:0071772	0.833	response to BMP
GO:0048522	0.827	positive regulation of cellular process
GO:0031323	0.816	regulation of cellular metabolic process
GO:0008152	0.765	metabolic process
GO:0071704	0.750	organic substance metabolic process
GO:0044238	0.743	primary metabolic process
GO:0044237	0.732	cellular metabolic process
GO:0048519	0.731	negative regulation of biological process
GO:0009893	0.693	positive regulation of metabolic process
GO:0006807	0.691	nitrogen compound metabolic process
GO:0043170	0.654	macromolecule metabolic process
GO:0010604	0.637	positive regulation of macromolecule metabolic process
GO:0048523	0.627	negative regulation of cellular process
GO:0048583	0.614	regulation of response to stimulus
GO:0010468	0.613	regulation of gene expression
GO:0001501	0.603	skeletal system development
GO:0060322	0.587	head development
GO:0009889	0.586	regulation of biosynthetic process
GO:0030509	0.555	BMP signaling pathway
GO:0023051	0.551	regulation of signaling
GO:0010646	0.551	regulation of cell communication
GO:0031326	0.546	regulation of cellular biosynthetic process
GO:0051173	0.542	positive regulation of nitrogen compound metabolic process
GO:0009887	0.535	animal organ morphogenesis
GO:0019538	0.535	protein metabolic process
GO:0061035	0.514	regulation of cartilage development
GO:0031325	0.513	positive regulation of cellular metabolic process
GO:0009888	0.495	tissue development
GO:0045595	0.487	regulation of cell differentiation
GO:0010556	0.466	regulation of macromolecule biosynthetic process
GO:0019219	0.457	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.443	regulation of RNA metabolic process
GO:0009966	0.441	regulation of signal transduction
GO:0009891	0.428	positive regulation of biosynthetic process
GO:2001141	0.417	regulation of RNA biosynthetic process
GO:0048584	0.413	positive regulation of response to stimulus
GO:0006355	0.408	regulation of DNA-templated transcription
GO:0045935	0.395	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.384	positive regulation of cellular biosynthetic process
GO:0010557	0.382	positive regulation of macromolecule biosynthetic process
GO:0051246	0.380	regulation of protein metabolic process
GO:0043010	0.380	camera-type eye development
GO:0023056	0.367	positive regulation of signaling
GO:0010647	0.367	positive regulation of cell communication
GO:0009967	0.344	positive regulation of signal transduction
GO:0042127	0.331	regulation of cell population proliferation
GO:0009892	0.329	negative regulation of metabolic process
GO:0007399	0.326	nervous system development
GO:0051174	0.320	regulation of phosphorus metabolic process
GO:0040012	0.314	regulation of locomotion
GO:0031399	0.308	regulation of protein modification process
GO:0090092	0.302	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005737	0.997	cytoplasm
GO:0098590	0.991	plasma membrane region
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0012505	0.988	endomembrane system
GO:0031974	0.987	membrane-enclosed lumen
GO:0042995	0.928	cell projection
GO:0036477	0.920	somatodendritic compartment
GO:0031981	0.919	nuclear lumen
GO:0120025	0.918	plasma membrane bounded cell projection
GO:0044297	0.917	cell body
GO:0043005	0.911	neuron projection
GO:0005576	0.894	extracellular region
GO:0097447	0.887	dendritic tree
GO:0005654	0.881	nucleoplasm
GO:0030425	0.870	dendrite
GO:0030054	0.855	cell junction
GO:0098857	0.842	membrane microdomain
GO:0005901	0.825	caveola
GO:0005615	0.785	extracellular space
GO:0045177	0.782	apical part of cell
GO:0045178	0.766	basal part of cell
GO:0009925	0.693	basal plasma membrane
GO:0016324	0.692	apical plasma membrane
GO:0043025	0.687	neuronal cell body
GO:0031982	0.534	vesicle
GO:0005829	0.458	cytosol
GO:0032991	0.311	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18673	0.999	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.999	receptor protein serine/threonine kinase.

[back to server]