StarFunc result for job id Q13882

User Input

>input (451 residues)
MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLLDEAGGAVAQG
YVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATGAFLIRVSEKPSADYVLSVRD
TQAVRHYKIWRRAGGRLHLNEAVSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPH
WDDWERPREEFTLCRKLGSGYFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMK
KLRHKHILALYAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGM
CYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIPYKWTAPEALS
RGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLM
LTCWCRDPEQRPCFKALRERLSSFTSYENPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13882	1.000	1.000	3.406E-92	451	1.000	1.000	Q13882.pdb.gz	PTK6_HUMAN Protein-tyrosine kinase 6 OS=Homo sapiens OX=9606 GN=PTK6 PE=1 SV=1
2	AFDB:Q64434	0.949	0.949	9.382E-78	451	0.800	0.800	Q64434.pdb.gz	PTK6_MOUSE Protein-tyrosine kinase 6 OS=Mus musculus OX=10090 GN=Ptk6 PE=1 SV=1
3	AFDB:J3QRU1	0.850	0.710	1.051E-51	548	0.441	0.363	J3QRU1.pdb.gz	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
4	AFDB:W5U6C9	0.896	0.812	2.816E-51	500	0.419	0.378	W5U6C9.pdb.gz	W5U6C9_ICTPU Tyrosine-protein kinase OS=Ictalurus punctatus OX=7998 GN=LCK PE=2 SV=1
5	AFDB:Q1JPZ3	0.818	0.700	4.870E-51	534	0.446	0.376	Q1JPZ3.pdb.gz	SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio OX=7955 GN=src PE=1 SV=2
6	AFDB:J3KPD6	0.855	0.742	7.973E-51	526	0.404	0.346	J3KPD6.pdb.gz	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	AFDB:Q9V9J3	0.844	0.745	1.170E-50	517	0.452	0.395	Q9V9J3.pdb.gz	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
8	AFDB:P42685	0.851	0.766	1.813E-50	505	0.441	0.394	P42685.pdb.gz	FRK_HUMAN Tyrosine-protein kinase FRK OS=Homo sapiens OX=9606 GN=FRK PE=1 SV=1
9	AFDB:P00528	0.867	0.715	4.860E-50	552	0.432	0.353	P00528.pdb.gz	SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster OX=7227 GN=Src64B PE=1 SV=3
10	AFDB:P09769	0.827	0.715	1.535E-49	529	0.441	0.376	P09769.pdb.gz	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
11	PDB:2h8hA	0.785	0.795	7.825E-47	445	0.450	0.456	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.554	0.566	4.960E-38	441	0.366	0.374	1k9aB.pdb.gz
13	PDB:4fl2A	0.519	0.426	3.515E-30	555	0.286	0.232	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.530	0.439	8.902E-29	551	0.271	0.221	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.480	0.743	1.684E-18	283	0.153	0.244	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:4krcA	0.508	0.755	3.626E-18	297	0.153	0.232	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
17	PDB:4rerA	0.505	0.496	2.605E-17	459	0.153	0.150	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:1unlA	0.513	0.773	2.752E-17	292	0.144	0.223	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:4eomC	0.517	0.820	1.025E-16	276	0.151	0.246	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:5ufuA	0.502	0.606	1.025E-16	369	0.153	0.187	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13882	0.0	937	451	1.000	1.000	PTK6_HUMAN Protein-tyrosine kinase 6 OS=Homo sapiens OX=9606 GN=PTK6 PE=1 SV=1
2	Q64434	0.0	782	451	0.800	0.800	PTK6_MOUSE Protein-tyrosine kinase 6 OS=Mus musculus OX=10090 GN=Ptk6 PE=1 SV=1
3	Q6EWH2	2.43e-132	394	537	0.437	0.367	FYNA_DANRE Tyrosine-protein kinase fyna OS=Danio rerio OX=7955 GN=fyna PE=1 SV=2
4	Q9V9J3	6.28e-130	387	517	0.452	0.395	SRC42_DROME Tyrosine-protein kinase Src42A OS=Drosophila melanogaster OX=7227 GN=Src42A PE=1 SV=1
5	P09324	1.24e-129	387	541	0.441	0.368	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
6	F1RDG9	1.53e-129	387	544	0.430	0.357	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
7	Q62662	3.49e-129	385	506	0.450	0.401	FRK_RAT Tyrosine-protein kinase FRK OS=Rattus norvegicus OX=10116 GN=Frk PE=1 SV=3
8	P39688	4.20e-129	385	537	0.430	0.361	FYN_MOUSE Tyrosine-protein kinase Fyn OS=Mus musculus OX=10090 GN=Fyn PE=1 SV=4
9	P06241	5.33e-129	385	537	0.430	0.361	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
10	P07947	6.84e-129	385	543	0.439	0.365	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
11	J3QRU1	9.37e-129	385	548	0.439	0.361	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
12	Q62844	1.15e-128	384	537	0.430	0.361	FYN_RAT Tyrosine-protein kinase Fyn OS=Rattus norvegicus OX=10116 GN=Fyn PE=1 SV=1
13	Q04736	1.34e-128	384	541	0.439	0.366	YES_MOUSE Tyrosine-protein kinase Yes OS=Mus musculus OX=10090 GN=Yes1 PE=1 SV=3
14	F1LM93	2.31e-128	384	541	0.439	0.366	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
15	P12931	3.31e-127	381	536	0.452	0.381	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3
16	P00523	3.36e-127	380	533	0.455	0.385	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
17	Q1JPZ3	9.28e-127	379	534	0.450	0.380	SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio OX=7955 GN=src PE=1 SV=2
18	P05480	1.64e-126	379	535	0.450	0.379	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
19	Q9WUD9	1.99e-126	379	536	0.450	0.379	SRC_RAT Proto-oncogene tyrosine-protein kinase Src OS=Rattus norvegicus OX=10116 GN=Src PE=1 SV=4
20	P42685	2.44e-126	377	505	0.441	0.394	FRK_HUMAN Tyrosine-protein kinase FRK OS=Homo sapiens OX=9606 GN=FRK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	5.8e+02	10.9	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	1.1	19.8	Haspin like kinase domain
3	PF06293 Kdo	61	14.5	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF00069 Pkinase	2e-45	166.8	Protein kinase domain
5	PF07714 PK_Tyr_Ser-Thr	9.7e-87	302.1	Protein tyrosine and serine/threonine kinase
6	PF00017 SH2	5.9e-15	66.5	SH2 domain
7	PF00018 SH3_1	4.3e-05	34.3	SH3 domain
8	PF07653 SH3_2	0.00044	31.3	Variant SH3 domain
9	PF14604 SH3_9	0.00029	32.0	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000442460

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000468927	0.988	Signal transducing adaptor family member 2
2	9606.ENSP00000313829	0.969	KH domain-containing, RNA-binding, signal transduction-associated protein 1
3	9606.ENSP00000437955	0.961	Hypoxia-inducible factor 1-alpha
4	9606.ENSP00000348108	0.957	KH domain-containing, RNA-binding, signal transduction-associated protein 3
5	9606.ENSP00000281156	0.951	KH domain-containing, RNA-binding, signal transduction-associated protein 2
6	9606.ENSP00000264033	0.938	E3 ubiquitin-protein ligase CBL
7	9606.ENSP00000349748	0.929	Splicing factor, proline- and glutamine-rich
8	9606.ENSP00000263734	0.928	Endothelial PAS domain-containing protein 1
9	9606.ENSP00000265734	0.921	Cyclin-dependent kinase 6
10	9606.ENSP00000385720	0.921	Rho GTPase-activating protein 35
11	9606.ENSP00000231509	0.913	Glucocorticoid receptor
12	9606.ENSP00000301396	0.911	Proline-, glutamic acid- and leucine-rich protein 1
13	9606.ENSP00000217188	0.910	Tyrosine-protein kinase Srms
14	9606.ENSP00000267257	0.906	Paxillin
15	9606.ENSP00000275493	0.906	Epidermal growth factor receptor
16	9606.ENSP00000384849	0.906	Cyclin-dependent kinase inhibitor 1
17	9606.ENSP00000413720	0.904	Cyclin-dependent kinase inhibitor 1C
18	9606.ENSP00000261254	0.900	G1/S-specific cyclin-D2
19	9606.ENSP00000362082	0.900	G1/S-specific cyclin-D3
20	9606.ENSP00000269571	0.897	Receptor tyrosine-protein kinase erbB-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0004715	0.986	non-membrane spanning protein tyrosine kinase activity
GO:0042802	0.869	identical protein binding
GO:0019899	0.577	enzyme binding
GO:0019900	0.468	kinase binding
GO:0005102	0.366	signaling receptor binding
GO:0019901	0.365	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0048522	0.981	positive regulation of cellular process
GO:0050896	0.971	response to stimulus
GO:0080090	0.925	regulation of primary metabolic process
GO:0031323	0.925	regulation of cellular metabolic process
GO:0071704	0.922	organic substance metabolic process
GO:0044237	0.914	cellular metabolic process
GO:0044238	0.905	primary metabolic process
GO:0006807	0.869	nitrogen compound metabolic process
GO:0051716	0.861	cellular response to stimulus
GO:0018108	0.857	peptidyl-tyrosine phosphorylation
GO:0051171	0.844	regulation of nitrogen compound metabolic process
GO:0060255	0.842	regulation of macromolecule metabolic process
GO:0023052	0.822	signaling
GO:0007154	0.812	cell communication
GO:0048523	0.799	negative regulation of cellular process
GO:0010646	0.796	regulation of cell communication
GO:0023051	0.768	regulation of signaling
GO:0007165	0.721	signal transduction
GO:0009893	0.607	positive regulation of metabolic process
GO:0048583	0.606	regulation of response to stimulus
GO:0010604	0.586	positive regulation of macromolecule metabolic process
GO:0051246	0.552	regulation of protein metabolic process
GO:0031399	0.536	regulation of protein modification process
GO:0051173	0.532	positive regulation of nitrogen compound metabolic process
GO:0051174	0.504	regulation of phosphorus metabolic process
GO:0031325	0.497	positive regulation of cellular metabolic process
GO:0009966	0.469	regulation of signal transduction
GO:0009892	0.457	negative regulation of metabolic process
GO:0065009	0.440	regulation of molecular function
GO:0042325	0.428	regulation of phosphorylation
GO:0007166	0.417	cell surface receptor signaling pathway
GO:0051247	0.414	positive regulation of protein metabolic process
GO:0050790	0.393	regulation of catalytic activity
GO:0032501	0.389	multicellular organismal process
GO:0051128	0.389	regulation of cellular component organization
GO:0032502	0.384	developmental process
GO:0007169	0.381	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048856	0.374	anatomical structure development
GO:0001932	0.347	regulation of protein phosphorylation
GO:0045859	0.342	regulation of protein kinase activity
GO:0042221	0.338	response to chemical
GO:0001934	0.338	positive regulation of protein phosphorylation
GO:0010605	0.326	negative regulation of macromolecule metabolic process
GO:0046777	0.319	protein autophosphorylation
GO:0048584	0.318	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0005654	0.940	nucleoplasm
GO:0016020	0.919	membrane
GO:0071944	0.766	cell periphery
GO:0005886	0.557	plasma membrane
GO:0032991	0.308	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.986	non-specific protein-tyrosine kinase.

[back to server]