StarFunc result for job id Q13885

User Input

>input (445 residues)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BUF5	0.992	0.990	2.207E-81	446	0.908	0.906	Q9BUF5.pdb.gz	TBB6_HUMAN Tubulin beta-6 chain OS=Homo sapiens OX=9606 GN=TUBB6 PE=1 SV=1
2	AFDB:P12456	0.971	0.979	5.541E-81	441	0.912	0.921	P12456.pdb.gz	TBB1_CAEEL Tubulin beta-1 chain OS=Caenorhabditis elegans OX=6239 GN=mec-7 PE=2 SV=1
3	AFDB:Q8AYC4	0.989	0.991	1.120E-80	444	0.946	0.948	Q8AYC4.pdb.gz
4	AFDB:P52275	0.969	0.958	6.341E-80	450	0.879	0.869	P52275.pdb.gz	TBB2_CAEEL Tubulin beta-2 chain OS=Caenorhabditis elegans OX=6239 GN=tbb-2 PE=1 SV=1
5	AFDB:P08841	0.962	0.943	6.511E-79	454	0.885	0.868	P08841.pdb.gz	TBB3_DROME Tubulin beta-3 chain OS=Drosophila melanogaster OX=7227 GN=betaTub60D PE=2 SV=2
6	AFDB:A6NNZ2	0.983	0.985	1.004E-78	444	0.861	0.863	A6NNZ2.pdb.gz	TBB8B_HUMAN Tubulin beta 8B OS=Homo sapiens OX=9606 GN=TUBB8B PE=1 SV=1
7	AFDB:B1PBW2	0.988	0.977	1.679E-77	450	0.845	0.836	B1PBW2.pdb.gz	B1PBW2_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1
8	AFDB:P10653	0.979	0.975	2.590E-77	447	0.813	0.810	P10653.pdb.gz	TBB1_EMENI Tubulin beta-1 chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=benA PE=3 SV=1
9	AFDB:Q4GYY6	0.987	0.994	2.886E-77	442	0.838	0.844	Q4GYY6.pdb.gz	Q4GYY6_TRYB2 Tubulin beta chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.2330 PE=3 SV=1
10	AFDB:Q6VAF5	0.970	0.972	4.451E-77	444	0.807	0.809	Q6VAF5.pdb.gz	TBB7_GOSHI Tubulin beta-7 chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1
11	PDB:7pqcA	0.947	0.947	8.560E-70	445	0.964	0.964	7pqcA.pdb.gz	A Structural Ensemble of a Tau-Microtubule Complex Reveals Regulatory Tau Phosphorylation and Acetylation Mechanisms.
12	PDB:7un1KH	0.873	0.961	3.044E-62	403	0.881	0.973	7un1KH.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
13	PDB:5w3fB	0.929	0.967	5.509E-58	427	0.733	0.763	5w3fB.pdb.gz	Structural differences between yeast and mammalian microtubules revealed by cryo-EM.
14	PDB:5mlvI	0.931	0.963	9.996E-58	430	0.748	0.774	5mlvI.pdb.gz
15	PDB:7un1FH	0.827	0.968	5.212E-56	379	0.829	0.974	7un1FH.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:4i4tA	0.908	0.904	7.990E-46	447	0.400	0.398	4i4tA.pdb.gz	Molecular Mechanism of Action of Microtubule-Stabilizing Anticancer Agents.
17	PDB:7nvnT	0.669	0.964	9.640E-43	307	0.681	0.987	7nvnT.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
18	PDB:5w3fA	0.927	0.937	2.848E-42	440	0.404	0.409	5w3fA.pdb.gz	Structural differences between yeast and mammalian microtubules revealed by cryo-EM.
19	PDB:6e88A	0.904	0.926	9.377E-42	434	0.389	0.399	6e88A.pdb.gz	The Structure and Dynamics of C. elegans Tubulin Reveals the Mechanistic Basis of Microtubule Growth.
20	PDB:2btqA	0.911	0.930	1.229E-41	436	0.346	0.353	2btqA.pdb.gz	Structure of Bacterial Tubulin Btuba/B: Evidence for Horizontal Gene Transfer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A075B736	712	407	0.791	0.865	A0A075B736_HUMAN Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB8 PE=1 SV=1
2	A0A0B4J269	809	797	0.879	0.491	A0A0B4J269_HUMAN G-protein coupled receptors family 1 profile domain-containing protein OS=Homo sapiens OX=9606 PE=1 SV=1
3	A0A1D8PC97	695	449	0.748	0.742	A0A1D8PC97_CANAL Tubulin beta chain OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TUB2 PE=3 SV=1
4	A0A384MEE3	932	445	0.996	0.996	A0A384MEE3_HUMAN Tubulin beta chain OS=Homo sapiens OX=9606 PE=2 SV=1
5	A1ZBL0	812	456	0.890	0.868	A1ZBL0_DROME Tubulin beta chain OS=Drosophila melanogaster OX=7227 GN=betaTub56D PE=1 SV=1
6	A2AQ07	726	451	0.778	0.767	TBB1_MOUSE Tubulin beta-1 chain OS=Mus musculus OX=10090 GN=Tubb1 PE=1 SV=1
7	A6NNZ2	778	444	0.845	0.847	TBB8B_HUMAN Tubulin beta 8B OS=Homo sapiens OX=9606 GN=TUBB8B PE=1 SV=1
8	B1PBV8	781	446	0.838	0.836	B1PBV8_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1
9	B1PBV9	783	448	0.838	0.833	B1PBV9_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 GN=LOC107888744 PE=2 SV=1
10	B1PBW0	777	449	0.831	0.824	B1PBW0_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 GN=LOC107938139 PE=2 SV=1
11	B1PBW1	773	447	0.822	0.819	B1PBW1_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1
12	B1PBW2	776	450	0.829	0.820	B1PBW2_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1
13	B1PBW4	789	445	0.847	0.847	B1PBW4_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 GN=LOC107941165 PE=2 SV=1
14	B1PBW6	790	445	0.847	0.847	B1PBW6_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 PE=2 SV=1
15	B1PBW7	777	444	0.834	0.836	B1PBW7_GOSHI Tubulin beta chain OS=Gossypium hirsutum OX=3635 GN=LOC107943613 PE=2 SV=1
16	K7ESM5	616	338	0.701	0.923	K7ESM5_HUMAN Tubulin beta chain (Fragment) OS=Homo sapiens OX=9606 GN=TUBB6 PE=1 SV=1
17	O17921	816	449	0.885	0.878	O17921_CAEEL Tubulin beta chain OS=Caenorhabditis elegans OX=6239 GN=tbb-1 PE=1 SV=1
18	P02554	925	445	0.987	0.987	TBB_PIG Tubulin beta chain OS=Sus scrofa OX=9823 PE=1 SV=1
19	P02557	697	457	0.751	0.731	TBB_YEAST Tubulin beta chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUB2 PE=1 SV=2
20	P04350	848	444	0.924	0.926	TBB4A_HUMAN Tubulin beta-4A chain OS=Homo sapiens OX=9606 GN=TUBB4A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10644 Misat_Tub_SegII	0.078	24.7	Misato Segment II tubulin-like domain
2	PF00091 Tubulin	3.3e-65	231.5	Tubulin/FtsZ family, GTPase domain
3	PF13809 Tubulin_2	1e+02	13.5	Tubulin like
4	PF14881 Tubulin_3	71	14.5	Tubulin domain
5	PF03953 Tubulin_C	1.8e-39	146.2	Tubulin C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 8153.XP_005925234.1

Rank	PPI partner	STRING score	Description
1	8153.XP_005920049.1	0.950	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 39 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
2	8153.XP_005939265.1	0.950	Lysine-specific demethylase 6B-like
3	8153.XP_005925687.1	0.914	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 5 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
4	8153.XP_005939547.1	0.900	WD repeat-containing protein 90-like isoform X1
5	8153.XP_005917850.1	0.895	Retinoblastoma-binding protein 5-like isoform X1
6	8153.XP_005937999.1	0.890	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	8153.XP_005920157.1	0.880	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns
8	8153.XP_005947964.1	0.873	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 3 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
9	8153.XP_005930691.1	0.872	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
10	8153.XP_005922978.1	0.866	Ankyrin repeat domain-containing protein 32-like
11	8153.XP_005942859.1	0.830	Cytoplasmic dynein 2 heavy chain 1-like
12	8153.XP_005952409.1	0.826	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
13	8153.XP_005936193.1	0.822	Nibrin-like
14	8153.XP_005940331.1	0.808	Nuclear receptor coactivator 6-like
15	8153.XP_005914923.1	0.800	Structural maintenance of chromosomes protein 5-like
16	8153.XP_005922633.1	0.799	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
17	8153.XP_005918939.1	0.794	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
18	8153.XP_005932718.1	0.794	Tubulin alpha chain-like
19	8153.XP_005919949.1	0.785	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
20	8153.XP_005918412.1	0.784	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.710	structural molecule activity
GO:0005200	0.695	structural constituent of cytoskeleton
GO:0097159	0.686	organic cyclic compound binding
GO:1901363	0.685	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0032501	0.983	multicellular organismal process
GO:0032502	0.982	developmental process
GO:0048856	0.974	anatomical structure development
GO:0007275	0.950	multicellular organism development
GO:0065007	0.916	biological regulation
GO:0050789	0.905	regulation of biological process
GO:0048731	0.903	system development
GO:0050794	0.898	regulation of cellular process
GO:0007399	0.697	nervous system development
GO:0071840	0.657	cellular component organization or biogenesis
GO:0016043	0.613	cellular component organization
GO:0050896	0.535	response to stimulus
GO:0006996	0.483	organelle organization
GO:0007017	0.441	microtubule-based process
GO:0051128	0.409	regulation of cellular component organization
GO:0051179	0.402	localization
GO:0007010	0.356	cytoskeleton organization
GO:0048518	0.336	positive regulation of biological process
GO:0048519	0.317	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	0.997	microtubule cytoskeleton
GO:0099081	0.985	supramolecular polymer
GO:0099513	0.983	polymeric cytoskeletal fiber
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0005874	0.972	microtubule
GO:0005737	0.968	cytoplasm
GO:0005819	0.964	spindle
GO:0005634	0.946	nucleus
GO:0005829	0.943	cytosol
GO:0031982	0.879	vesicle
GO:0005576	0.843	extracellular region
GO:0045171	0.765	intercellular bridge
GO:0070062	0.736	extracellular exosome
GO:0120025	0.545	plasma membrane bounded cell projection
GO:0072686	0.401	mitotic spindle
GO:0016020	0.389	membrane
GO:0012505	0.364	endomembrane system
GO:0071944	0.320	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]