StarFunc result for job id Q13886

User Input

>input (244 residues)
MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTL
VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSA
PSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDC
LKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKAL
ANAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R260	0.532	0.532	6.273E-38	244	1.000	1.000	A0A024R260.pdb.gz
2	AFDB:Q9JJZ6	0.370	0.314	1.323E-15	289	0.459	0.388	Q9JJZ6.pdb.gz	KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus OX=10090 GN=Klf13 PE=1 SV=2
3	AFDB:A8E7A9	0.375	0.366	1.413E-15	250	0.385	0.376	A8E7A9.pdb.gz	A8E7A9_DANRE Krueppel-like factor 16 OS=Danio rerio OX=7955 GN=wu:fi22b08 PE=4 SV=1
4	AFDB:Q9BXK1	0.362	0.351	1.406E-14	252	0.398	0.385	Q9BXK1.pdb.gz	KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens OX=9606 GN=KLF16 PE=1 SV=1
5	AFDB:A2BGS7	0.383	0.430	3.091E-14	216	0.398	0.449	A2BGS7.pdb.gz	A2BGS7_DANRE Krueppel-like factor 9 OS=Danio rerio OX=7955 GN=si:dkey-201c13.3 PE=2 SV=1
6	AFDB:P58334	0.366	0.356	3.764E-14	251	0.324	0.315	P58334.pdb.gz	KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus OX=10090 GN=Klf16 PE=1 SV=2
7	AFDB:Q4R0P9	0.358	0.206	3.076E-13	428	0.320	0.182	Q4R0P9.pdb.gz	Q4R0P9_DROME Cabut OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
8	AFDB:A0A024R3X8	0.351	0.286	3.285E-13	302	0.275	0.222	A0A024R3X8.pdb.gz
9	AFDB:O08876	0.388	0.203	3.508E-13	480	0.361	0.183	O08876.pdb.gz	KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus OX=10116 GN=Klf10 PE=2 SV=1
10	AFDB:O62259	0.351	0.287	4.561E-13	299	0.299	0.244	O62259.pdb.gz	KLF2_CAEEL Kruppel-like factor 2 OS=Caenorhabditis elegans OX=6239 GN=klf-2 PE=2 SV=2
11	PDB:3w5kB	0.122	0.214	1.840E-2	110	0.115	0.255	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5c8dE	0.072	0.065	3.081	280	0.033	0.029	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
13	PDB:5dvbA	0.098	0.115	5.562	199	0.016	0.020	5dvbA.pdb.gz
14	PDB:7w59R	0.114	0.103	6.343	280	0.119	0.104	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
15	PDB:8a8mB	0.085	0.071	7.723	298	0.049	0.040	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13886	0.0	505	244	1.000	1.000	KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens OX=9606 GN=KLF9 PE=1 SV=1
2	Q01713	6.07e-177	487	244	0.967	0.967	KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus OX=10116 GN=Klf9 PE=2 SV=1
3	O35739	4.43e-175	483	244	0.963	0.963	KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus OX=10090 GN=Klf9 PE=2 SV=1
4	Q9Y2Y9	1.63e-60	194	288	0.484	0.410	KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens OX=9606 GN=KLF13 PE=1 SV=1
5	A2BGS7	2.49e-56	181	216	0.385	0.435	A2BGS7_DANRE Krueppel-like factor 9 OS=Danio rerio OX=7955 GN=si:dkey-201c13.3 PE=2 SV=1
6	A8E7A9	1.61e-55	180	250	0.463	0.452	A8E7A9_DANRE Krueppel-like factor 16 OS=Danio rerio OX=7955 GN=wu:fi22b08 PE=4 SV=1
7	Q9JJZ6	2.83e-51	170	289	0.299	0.253	KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus OX=10090 GN=Klf13 PE=1 SV=2
8	Q8TD94	3.64e-45	155	323	0.283	0.214	KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens OX=9606 GN=KLF14 PE=2 SV=2
9	Q19A41	1.22e-44	154	325	0.340	0.255	KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus OX=10090 GN=Klf14 PE=2 SV=1
10	P58334	1.86e-44	151	251	0.275	0.267	KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus OX=10090 GN=Klf16 PE=1 SV=2
11	Q9BXK1	3.79e-42	145	252	0.266	0.258	KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens OX=9606 GN=KLF16 PE=1 SV=1
12	O08876	3.63e-38	140	480	0.242	0.123	KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus OX=10116 GN=Klf10 PE=2 SV=1
13	Q13118	5.10e-38	140	480	0.242	0.123	KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens OX=9606 GN=KLF10 PE=1 SV=1
14	O89091	5.13e-38	140	479	0.242	0.123	KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus OX=10090 GN=Klf10 PE=1 SV=1
15	Q95R58	5.57e-38	137	347	0.246	0.173	Q95R58_DROME SD05726p OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
16	Q8IPV7	5.69e-38	137	347	0.246	0.173	Q8IPV7_DROME Cabut, isoform B OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
17	Q4R0P9	9.12e-38	138	428	0.246	0.140	Q4R0P9_DROME Cabut OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
18	Q9VPQ5	1.01e-37	138	428	0.246	0.140	Q9VPQ5_DROME Cabut, isoform A OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=2
19	Q6NW96	3.16e-37	137	439	0.246	0.137	SP9_DANRE Transcription factor Sp9 OS=Danio rerio OX=7955 GN=sp9 PE=2 SV=1
20	Q64HY4	3.47e-37	130	167	0.242	0.353	Q64HY4_CHICK SP9 (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19126 DUF5810	7.6e+02	11.6	Family of unknown function (DUF5810)
2	PF16159 FOXP-CC	2.9	19.7	FOXP coiled-coil domain
3	PF01485 IBR	8.9e+02	11.4	IBR domain, a half RING-finger domain
4	PF00096 zf-C2H2	6.3e-12	56.4	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	6.3e-05	34.5	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	2e+02	13.4	C2H2-type zinc finger
7	PF05605 zf-Di19	6.4e+02	12.1	Drought induced 19 protein (Di19), zinc-binding
8	PF13465 zf-H2C2_2	1.4e-10	52.3	Zinc-finger double domain
9	PF12874 zf-met	22	16.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366330

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378402	0.954	Paired amphipathic helix protein Sin3a
2	9606.ENSP00000325120	0.845	Progesterone receptor
3	9606.ENSP00000379904	0.736	Thyroid hormone receptor beta
4	9606.ENSP00000264637	0.721	Thyroid hormone receptor alpha
5	9606.ENSP00000267163	0.710	Retinoblastoma-associated protein
6	9606.ENSP00000352157	0.706	Mitogen-activated protein kinase 10
7	9606.ENSP00000366314	0.645	Transient receptor potential cation channel subfamily M member 3
8	9606.ENSP00000263635	0.591	Protein TANC1
9	9606.ENSP00000427514	0.551	CCAAT/enhancer-binding protein alpha
10	9606.ENSP00000408295	0.550	Replication factor C subunit 5
11	9606.ENSP00000343288	0.508	Forkhead box protein N3
12	9606.ENSP00000386165	0.506	CCAAT/enhancer-binding protein delta
13	9606.ENSP00000410269	0.505	Transmembrane protein 176B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:0003677	0.996	DNA binding
GO:0043565	0.989	sequence-specific DNA binding
GO:0000981	0.970	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.968	transcription cis-regulatory region binding
GO:0000977	0.939	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.681	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.653	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.329	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0019222	0.990	regulation of metabolic process
GO:0051716	0.989	cellular response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0071495	0.978	cellular response to endogenous stimulus
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0051171	0.969	regulation of nitrogen compound metabolic process
GO:0070887	0.969	cellular response to chemical stimulus
GO:0031323	0.969	regulation of cellular metabolic process
GO:0010033	0.967	response to organic substance
GO:0019219	0.933	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.893	regulation of macromolecule biosynthetic process
GO:0031326	0.892	regulation of cellular biosynthetic process
GO:0051252	0.887	regulation of RNA metabolic process
GO:0006355	0.880	regulation of DNA-templated transcription
GO:0071310	0.877	cellular response to organic substance
GO:0048518	0.717	positive regulation of biological process
GO:0048522	0.690	positive regulation of cellular process
GO:1901698	0.688	response to nitrogen compound
GO:0009893	0.666	positive regulation of metabolic process
GO:0071383	0.647	cellular response to steroid hormone stimulus
GO:0051173	0.624	positive regulation of nitrogen compound metabolic process
GO:0031325	0.623	positive regulation of cellular metabolic process
GO:0010604	0.618	positive regulation of macromolecule metabolic process
GO:1901701	0.615	cellular response to oxygen-containing compound
GO:0045935	0.545	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.526	positive regulation of macromolecule biosynthetic process
GO:0031328	0.526	positive regulation of cellular biosynthetic process
GO:0032501	0.516	multicellular organismal process
GO:0032502	0.499	developmental process
GO:0006357	0.491	regulation of transcription by RNA polymerase II
GO:0048519	0.463	negative regulation of biological process
GO:0007154	0.462	cell communication
GO:0051254	0.453	positive regulation of RNA metabolic process
GO:0048523	0.438	negative regulation of cellular process
GO:0045893	0.434	positive regulation of DNA-templated transcription
GO:0023052	0.432	signaling
GO:0007165	0.423	signal transduction
GO:0048856	0.422	anatomical structure development
GO:0045944	0.405	positive regulation of transcription by RNA polymerase II
GO:0009892	0.394	negative regulation of metabolic process
GO:0010605	0.384	negative regulation of macromolecule metabolic process
GO:0051172	0.307	negative regulation of nitrogen compound metabolic process
GO:0031324	0.307	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0016020	0.980	membrane
GO:0005829	0.953	cytosol
GO:0005886	0.919	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]