StarFunc result for job id Q13887

User Input

>input (457 residues)
MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQA
QPAPAQAPQPAQPPATGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVV
DQFFTDTEGLPYSINMNVFLPDITHLRTGLYKSQRPCVTHIKTEPVAIFSHQSETTAPPP
APTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQGHLYQLLNTPDLDMP
SSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF
PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYN
RRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDEL
TRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13887	1.000	1.000	8.920E-72	457	1.000	1.000	Q13887.pdb.gz	KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens OX=9606 GN=KLF5 PE=1 SV=2
2	AFDB:R9PY21	0.204	0.132	6.046E-13	720	0.232	0.147	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
3	AFDB:Q64HY5	0.199	0.190	3.263E-12	480	0.239	0.227	Q64HY5.pdb.gz	SP8_CHICK Transcription factor Sp8 OS=Gallus gallus OX=9031 GN=SP8 PE=2 SV=1
4	AFDB:Q8IXZ3	0.195	0.182	1.359E-11	490	0.234	0.218	Q8IXZ3.pdb.gz	SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens OX=9606 GN=SP8 PE=1 SV=3
5	AFDB:A0A0A0MT54	0.188	0.165	2.599E-11	522	0.241	0.211	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
6	AFDB:P11161	0.187	0.180	1.597E-10	476	0.228	0.218	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
7	AFDB:P41696	0.177	0.090	7.574E-10	914	0.182	0.091	P41696.pdb.gz	AZF1_YEAST Transcription factor AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AZF1 PE=1 SV=1
8	AFDB:Q96T25	0.189	0.136	4.654E-9	663	0.236	0.163	Q96T25.pdb.gz	ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens OX=9606 GN=ZIC5 PE=1 SV=2
9	AFDB:Q921B4	0.191	0.111	1.495E-8	824	0.182	0.101	Q921B4.pdb.gz	NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus OX=10090 GN=Nrif2 PE=1 SV=1
10	AFDB:Q8K1M4	0.151	0.091	1.938E-8	789	0.214	0.124	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
11	PDB:3w5kB	0.083	0.215	9.376E-3	110	0.061	0.255	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7dvqM	0.057	0.095	8.227E-1	191	0.059	0.141	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:7od1A	0.059	0.061	9.994E-1	430	0.044	0.047	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
14	PDB:6ff4t	0.052	0.112	1.573	172	0.055	0.145	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
15	PDB:7ls2Q2	0.053	0.158	1.791	110	0.044	0.182	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.
16	PDB:6lss7	0.070	0.165	2.643	135	0.042	0.141	6lss7.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
17	PDB:5dkaA	0.067	0.246	3.009	96	0.022	0.104	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
18	PDB:5c8dE	0.046	0.066	3.211	280	0.018	0.029	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
19	PDB:3mhhC	0.060	0.226	4.162	93	0.026	0.129	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
20	PDB:6tmuA	0.048	0.040	4.162	550	0.018	0.015	6tmuA.pdb.gz	Structure and conformational cycle of a bacteriophage-encoded chaperonin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LSL7	0.0	773	443	0.895	0.923	F1LSL7_RAT Kruppel-like factor 5 OS=Rattus norvegicus OX=10116 GN=Klf5 PE=4 SV=2
2	Q13887	0.0	941	457	1.000	1.000	KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens OX=9606 GN=KLF5 PE=1 SV=2
3	Q5T6X2	0.0	941	457	1.000	1.000	Q5T6X2_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=KLF5 PE=2 SV=1
4	Q66HP1	0.0	667	363	0.748	0.942	Q66HP1_RAT Klf5 protein OS=Rattus norvegicus OX=10116 GN=Klf5 PE=2 SV=1
5	Q9Z0Z7	0.0	757	446	0.886	0.908	KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus OX=10090 GN=Klf5 PE=1 SV=2
6	E9QG09	1.96e-140	411	429	0.538	0.573	E9QG09_DANRE Krueppel-like factor 5 OS=Danio rerio OX=7955 GN=pibf1 PE=4 SV=1
7	Q9VZN4	3.45e-54	195	751	0.179	0.109	DAR1_DROME Dendritic arbor reduction protein 1 OS=Drosophila melanogaster OX=7227 GN=dar1 PE=2 SV=2
8	O35738	8.07e-53	184	402	0.175	0.199	KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus OX=10090 GN=Klf12 PE=1 SV=2
9	Q9Y4X4	1.27e-52	184	402	0.175	0.199	KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens OX=9606 GN=KLF12 PE=1 SV=2
10	A0S0R1	3.28e-51	178	343	0.158	0.210	A0S0R1_DANRE Krueppel-like factor 8 OS=Danio rerio OX=7955 GN=si:ch211-208m1.2 PE=2 SV=1
11	O95600	1.28e-50	177	359	0.155	0.198	KLF8_HUMAN Krueppel-like factor 8 OS=Homo sapiens OX=9606 GN=KLF8 PE=1 SV=2
12	P57682	7.08e-50	175	345	0.195	0.258	KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens OX=9606 GN=KLF3 PE=1 SV=1
13	D4A4V3	7.27e-50	175	344	0.195	0.259	D4A4V3_RAT Kruppel like factor 3 OS=Rattus norvegicus OX=10116 GN=Klf3 PE=1 SV=1
14	O75840	8.47e-50	173	302	0.158	0.238	KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens OX=9606 GN=KLF7 PE=1 SV=1
15	Q60980	8.60e-50	174	344	0.168	0.224	KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus OX=10090 GN=Klf3 PE=1 SV=1
16	Q99JB0	1.14e-49	173	301	0.158	0.239	KLF7_MOUSE Krueppel-like factor 7 OS=Mus musculus OX=10090 GN=Klf7 PE=1 SV=1
17	Q5TYN4	2.23e-49	172	295	0.158	0.244	Q5TYN4_DANRE Klf7l protein OS=Danio rerio OX=7955 GN=klf7l PE=2 SV=1
18	A2BG67	8.46e-49	171	328	0.173	0.241	A2BG67_DANRE Krueppel-like factor 3 OS=Danio rerio OX=7955 GN=klf12 PE=4 SV=1
19	O08584	1.88e-48	169	283	0.160	0.258	KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus OX=10090 GN=Klf6 PE=2 SV=3
20	Q8MR37	2.45e-48	176	570	0.162	0.130	KLFL_DROME Krueppel-like factor luna OS=Drosophila melanogaster OX=7227 GN=luna PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	8.9	18.2	FOXP coiled-coil domain
2	PF00096 zf-C2H2	2.9e-13	60.6	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	1.6e-05	36.3	C2H2-type zinc finger
4	PF15909 zf-C2H2_8	2e+02	13.7	C2H2-type zinc ribbon
5	PF17017 zf-C2H2_aberr	1.2e+02	14.2	Aberrant zinc-finger
6	PF13465 zf-H2C2_2	3.1e-07	41.7	Zinc-finger double domain
7	PF12874 zf-met	3.8	19.2	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366915

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305422	0.995	CCAAT/enhancer-binding protein beta
2	9606.ENSP00000263253	0.991	Histone acetyltransferase p300
3	9606.ENSP00000427514	0.976	CCAAT/enhancer-binding protein alpha
4	9606.ENSP00000254066	0.973	Retinoic acid receptor alpha
5	9606.ENSP00000287820	0.962	Peroxisome proliferator-activated receptor gamma
6	9606.ENSP00000386165	0.950	CCAAT/enhancer-binding protein delta
7	9606.ENSP00000281708	0.915	F-box/WD repeat-containing protein 7
8	9606.ENSP00000262367	0.883	CREB-binding protein
9	9606.ENSP00000362649	0.880	Histone deacetylase 1
10	9606.ENSP00000360266	0.878	Transcription factor AP-1
11	9606.ENSP00000427793	0.871	NEDD4-like E3 ubiquitin-protein ligase WWP1
12	9606.ENSP00000343925	0.847	Estrogen receptor beta
13	9606.ENSP00000344456	0.842	Catenin beta-1
14	9606.ENSP00000341551	0.779	Mothers against decapentaplegic homolog 4
15	9606.ENSP00000345848	0.778	Acidic leucine-rich nuclear phosphoprotein 32 family member B
16	9606.ENSP00000269305	0.764	Cellular tumor antigen p53
17	9606.ENSP00000376303	0.740	Carnitine O-palmitoyltransferase 1, brain isoform
18	9606.ENSP00000226574	0.727	Nuclear factor NF-kappa-B p105 subunit
19	9606.ENSP00000379011	0.725	Carnitine O-palmitoyltransferase 1, muscle isoform
20	9606.ENSP00000401678	0.708	Myocardin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0048522	0.965	positive regulation of cellular process
GO:0009889	0.962	regulation of biosynthetic process
GO:0009891	0.928	positive regulation of biosynthetic process
GO:0080090	0.926	regulation of primary metabolic process
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0051171	0.922	regulation of nitrogen compound metabolic process
GO:0010468	0.902	regulation of gene expression
GO:0031326	0.899	regulation of cellular biosynthetic process
GO:0010556	0.889	regulation of macromolecule biosynthetic process
GO:0051252	0.885	regulation of RNA metabolic process
GO:0006355	0.883	regulation of DNA-templated transcription
GO:0045944	0.872	positive regulation of transcription by RNA polymerase II
GO:0050896	0.867	response to stimulus
GO:2000628	0.781	regulation of miRNA metabolic process
GO:0051716	0.703	cellular response to stimulus
GO:0048519	0.686	negative regulation of biological process
GO:0023052	0.684	signaling
GO:0007154	0.681	cell communication
GO:0048523	0.667	negative regulation of cellular process
GO:2000630	0.629	positive regulation of miRNA metabolic process
GO:0032501	0.486	multicellular organismal process
GO:0032502	0.479	developmental process
GO:0048856	0.445	anatomical structure development
GO:0042221	0.423	response to chemical
GO:0009892	0.377	negative regulation of metabolic process
GO:0010605	0.357	negative regulation of macromolecule metabolic process
GO:0007275	0.322	multicellular organism development
GO:1902893	0.321	regulation of miRNA transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.999	cytoplasm
GO:0012505	0.959	endomembrane system
GO:0032991	0.859	protein-containing complex
GO:0005794	0.637	Golgi apparatus
GO:0005667	0.604	transcription regulator complex
GO:0005829	0.303	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]