StarFunc result for job id Q13888

User Input

>input (395 residues)
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTEL
SGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPS
NIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13888	1.000	1.000	1.924E-85	395	1.000	1.000	Q13888.pdb.gz	TF2H2_HUMAN General transcription factor IIH subunit 2 OS=Homo sapiens OX=9606 GN=GTF2H2 PE=1 SV=1
2	AFDB:Q9VNP8	0.894	0.809	1.983E-54	438	0.514	0.463	Q9VNP8.pdb.gz	Q9VNP8_DROME General transcription factor IIH subunit OS=Drosophila melanogaster OX=7227 GN=Ssl1 PE=1 SV=2
3	PDB:7ena2	0.824	0.843	4.067E-54	385	0.975	1.000	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
4	AFDB:Q9ZVN9	0.830	0.782	5.494E-48	421	0.433	0.406	Q9ZVN9.pdb.gz	TF2H2_ARATH General transcription factor IIH subunit 2 OS=Arabidopsis thaliana OX=3702 GN=GTF2H2 PE=1 SV=1
5	PDB:7ad8D	0.562	0.772	3.670E-46	280	0.694	0.979	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
6	AFDB:Q04673	0.854	0.737	1.152E-45	461	0.397	0.341	Q04673.pdb.gz	SSL1_YEAST General transcription and DNA repair factor IIH subunit SSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSL1 PE=1 SV=1
7	AFDB:O74995	0.851	0.799	1.753E-45	421	0.390	0.366	O74995.pdb.gz	TFH47_SCHPO General transcription and DNA repair factor IIH subunit ssl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssl1 PE=1 SV=1
8	PDB:7zs96	0.813	0.838	2.312E-41	383	0.387	0.399	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
9	AFDB:Q8IEG6	0.846	0.834	8.856E-39	401	0.268	0.264	Q8IEG6.pdb.gz	Q8IEG6_PLAF7 General transcription factor IIH subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1314900 PE=3 SV=1
10	PDB:6gym6	0.763	0.893	1.426E-32	335	0.327	0.385	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
11	AFDB:Q57TV9	0.714	0.800	4.124E-28	351	0.213	0.239	Q57TV9.pdb.gz	Q57TV9_TRYB2 DNA repair and transcription factor protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.310 PE=4 SV=1
12	AFDB:P38886	0.385	0.550	3.787E-12	268	0.094	0.138	P38886.pdb.gz	RPN10_YEAST 26S proteasome regulatory subunit RPN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN10 PE=1 SV=3
13	AFDB:O88321	0.367	0.381	4.535E-12	380	0.094	0.097	O88321.pdb.gz
14	AFDB:P55034	0.379	0.388	8.780E-12	386	0.073	0.075	P55034.pdb.gz	PSMD4_ARATH 26S proteasome non-ATPase regulatory subunit 4 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN10 PE=1 SV=1
15	PDB:6gvwD	0.376	0.593	1.307E-10	239	0.078	0.130	6gvwD.pdb.gz	Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation.
16	PDB:7egb3	0.375	0.545	1.565E-10	263	0.106	0.160	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
17	PDB:5l4kW	0.356	0.688	4.899E-10	196	0.089	0.179	5l4kW.pdb.gz
18	PDB:7ena3	0.354	0.459	5.748E-9	295	0.106	0.142	7ena3.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:3jcoW	0.355	0.675	1.415E-8	197	0.084	0.168	3jcoW.pdb.gz
20	PDB:7zsb4	0.382	0.483	5.632E-8	306	0.094	0.121	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13888	0.0	821	395	1.000	1.000	TF2H2_HUMAN General transcription factor IIH subunit 2 OS=Homo sapiens OX=9606 GN=GTF2H2 PE=1 SV=1
2	Q6P1K8	0.0	816	395	0.992	0.992	T2H2L_HUMAN General transcription factor IIH subunit 2-like protein OS=Homo sapiens OX=9606 GN=GTF2H2C PE=1 SV=1
3	Q9VNP8	1.55e-144	419	438	0.527	0.475	Q9VNP8_DROME General transcription factor IIH subunit OS=Drosophila melanogaster OX=7227 GN=Ssl1 PE=1 SV=2
4	Q9ZVN9	2.90e-105	318	421	0.428	0.401	TF2H2_ARATH General transcription factor IIH subunit 2 OS=Arabidopsis thaliana OX=3702 GN=GTF2H2 PE=1 SV=1
5	O74995	2.86e-96	295	421	0.395	0.371	TFH47_SCHPO General transcription and DNA repair factor IIH subunit ssl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssl1 PE=1 SV=1
6	Q04673	1.83e-95	295	461	0.390	0.334	SSL1_YEAST General transcription and DNA repair factor IIH subunit SSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSL1 PE=1 SV=1
7	Q8IEG6	1.09e-53	185	401	0.273	0.269	Q8IEG6_PLAF7 General transcription factor IIH subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1314900 PE=3 SV=1
8	Q57TV9	1.27e-18	88.6	351	0.185	0.208	Q57TV9_TRYB2 DNA repair and transcription factor protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.310 PE=4 SV=1
9	O94444	0.003	41.2	243	0.071	0.115	RPN10_SCHPO 26S proteasome regulatory subunit rpn10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn10 PE=1 SV=1
10	P38886	0.016	39.3	268	0.109	0.160	RPN10_YEAST 26S proteasome regulatory subunit RPN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN10 PE=1 SV=3
11	A0A8I6A4A3	0.032	38.5	379	0.091	0.095	A0A8I6A4A3_RAT 26S proteasome non-ATPase regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Psmd4 PE=1 SV=1
12	P55034	0.052	38.1	386	0.066	0.067	PSMD4_ARATH 26S proteasome non-ATPase regulatory subunit 4 homolog OS=Arabidopsis thaliana OX=3702 GN=RPN10 PE=1 SV=1
13	Q9ESH1	0.071	37.4	377	0.091	0.095	Q9ESH1_RAT 26S proteasome non-ATPase regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Psmd4 PE=1 SV=1
14	Q5VWC4	0.083	37.4	380	0.091	0.095	Q5VWC4_HUMAN 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1
15	P55036	0.084	37.4	377	0.091	0.095	PSMD4_HUMAN 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1
16	O35226	0.086	37.4	376	0.091	0.096	PSMD4_MOUSE 26S proteasome non-ATPase regulatory subunit 4 OS=Mus musculus OX=10090 GN=Psmd4 PE=1 SV=1
17	Q9I4X3	1.0	33.9	517	0.053	0.041	PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pqsA PE=1 SV=1
18	Q9QUR2	4.2	32.0	467	0.046	0.039	DCTN4_RAT Dynactin subunit 4 OS=Rattus norvegicus OX=10116 GN=Dctn4 PE=1 SV=1
19	Q803G5	4.8	32.0	469	0.089	0.075	SAM5A_DANRE Sorting and assembly machinery component 50 homolog A OS=Danio rerio OX=7955 GN=samm50a PE=2 SV=1
20	Q38FG4	7.8	31.2	1366	0.056	0.016	Q38FG4_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2290 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	1.1e-07	43.3	TFIIH C1-like domain
2	PF12773 DZR	2.2e+02	13.2	Double zinc ribbon
3	PF18256 HscB_4_cys	1.3e+02	13.9	Co-chaperone HscB tetracysteine metal binding motif
4	PF04056 Ssl1	4.2e-91	315.5	Ssl1-like
5	PF00092 VWA	0.0051	28.6	von Willebrand factor type A domain
6	PF13519 VWA_2	4.7e-10	51.4	von Willebrand factor type A domain
7	PF13768 VWA_3	1.1e+02	14.2	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328901

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256443	0.999	Cyclin-dependent kinase 7
2	9606.ENSP00000256897	0.999	Cyclin-H
3	9606.ENSP00000259895	0.999	General transcription factor IIH subunit 4
4	9606.ENSP00000261245	0.999	CDK-activating kinase assembly factor MAT1
5	9606.ENSP00000265963	0.999	General transcription factor IIH subunit 1
6	9606.ENSP00000285398	0.999	TFIIH basal transcription factor complex helicase XPB subunit
7	9606.ENSP00000375809	0.999	TFIIH basal transcription factor complex helicase XPD subunit
8	9606.ENSP00000445162	0.999	General transcription factor IIH subunit 3
9	9606.ENSP00000476100	0.999	General transcription factor IIH subunit 5
10	9606.ENSP00000283875	0.997	General transcription factor IIE subunit 1
11	9606.ENSP00000348168	0.997	Transcription initiation factor IIE subunit beta
12	9606.ENSP00000359531	0.991	Transcription initiation factor IIB
13	9606.ENSP00000377969	0.988	General transcription factor IIF subunit 1
14	9606.ENSP00000379372	0.987	Transcription initiation factor IIA subunit 2
15	9606.ENSP00000375942	0.986	TATA-box-binding protein
16	9606.ENSP00000452454	0.985	Transcription initiation factor IIA subunit 1
17	9606.ENSP00000428426	0.984	Transcription elongation factor A protein 1
18	9606.ENSP00000364270	0.977	DNA repair protein complementing XP-A cells
19	9606.ENSP00000412698	0.962	MMS19 nucleotide excision repair protein homolog
20	9606.ENSP00000422907	0.960	General transcription factor IIH subunit 2-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016251	0.998	RNA polymerase II general transcription initiation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006366	0.978	transcription by RNA polymerase II
GO:0065007	0.942	biological regulation
GO:0050789	0.909	regulation of biological process
GO:0050794	0.892	regulation of cellular process
GO:0050896	0.761	response to stimulus
GO:0006352	0.544	DNA-templated transcription initiation
GO:0019222	0.498	regulation of metabolic process
GO:0006367	0.492	transcription initiation at RNA polymerase II promoter
GO:0051716	0.484	cellular response to stimulus
GO:0060255	0.473	regulation of macromolecule metabolic process
GO:0044260	0.473	cellular macromolecule metabolic process
GO:0080090	0.467	regulation of primary metabolic process
GO:0051171	0.467	regulation of nitrogen compound metabolic process
GO:0031323	0.451	regulation of cellular metabolic process
GO:0006974	0.416	cellular response to DNA damage stimulus
GO:0006259	0.394	DNA metabolic process
GO:0019219	0.376	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.328	positive regulation of cellular process
GO:0009889	0.321	regulation of biosynthetic process
GO:0010556	0.310	regulation of macromolecule biosynthetic process
GO:0031326	0.309	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	0.995	nuclear protein-containing complex
GO:0016604	0.995	nuclear body
GO:1902494	0.990	catalytic complex
GO:0016591	0.984	RNA polymerase II, holoenzyme
GO:0090575	0.958	RNA polymerase II transcription regulator complex
GO:0016607	0.947	nuclear speck
GO:1902554	0.818	serine/threonine protein kinase complex
GO:0032806	0.689	carboxy-terminal domain protein kinase complex
GO:0000439	0.618	transcription factor TFIIH core complex
GO:0005675	0.585	transcription factor TFIIH holo complex
GO:0005669	0.567	transcription factor TFIID complex
GO:0043232	0.503	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]