StarFunc result for job id Q13889

User Input

>input (308 residues)
MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVI
ASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMT
KSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNV
IFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQ
LILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAK
KKKLKVSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13889	1.000	1.000	1.013E-64	308	1.000	1.000	Q13889.pdb.gz	TF2H3_HUMAN General transcription factor IIH subunit 3 OS=Homo sapiens OX=9606 GN=GTF2H3 PE=1 SV=2
2	PDB:7ena3	0.814	0.847	7.299E-45	295	0.958	1.000	7ena3.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
3	PDB:7egb3	0.790	0.918	1.063E-44	263	0.854	1.000	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
4	AFDB:F5GWD3	0.756	0.894	1.267E-43	258	0.831	0.992	F5GWD3.pdb.gz	F5GWD3_HUMAN General transcription factor IIH subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=GTF2H3 PE=1 SV=1
5	AFDB:O74366	0.791	0.819	3.283E-31	297	0.354	0.367	O74366.pdb.gz	TFB4_SCHPO General transcription and DNA repair factor IIH subunit tfb4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfb4 PE=1 SV=1
6	AFDB:Q12004	0.806	0.738	1.710E-25	338	0.312	0.284	Q12004.pdb.gz	TFB4_YEAST General transcription and DNA repair factor IIH subunit TFB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFB4 PE=1 SV=1
7	PDB:7zsb4	0.768	0.772	9.443E-22	306	0.282	0.284	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
8	PDB:5oqj4	0.703	0.726	3.266E-18	297	0.240	0.249	5oqj4.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
9	AFDB:Q9ZVN9	0.445	0.335	5.787E-12	421	0.166	0.121	Q9ZVN9.pdb.gz	TF2H2_ARATH General transcription factor IIH subunit 2 OS=Arabidopsis thaliana OX=3702 GN=GTF2H2 PE=1 SV=1
10	AFDB:Q8IEG6	0.492	0.386	2.447E-11	401	0.149	0.115	Q8IEG6.pdb.gz	Q8IEG6_PLAF7 General transcription factor IIH subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1314900 PE=3 SV=1
11	AFDB:Q04673	0.450	0.315	5.191E-11	461	0.123	0.082	Q04673.pdb.gz	SSL1_YEAST General transcription and DNA repair factor IIH subunit SSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSL1 PE=1 SV=1
12	AFDB:Q13888	0.451	0.360	2.649E-10	395	0.153	0.119	Q13888.pdb.gz	TF2H2_HUMAN General transcription factor IIH subunit 2 OS=Homo sapiens OX=9606 GN=GTF2H2 PE=1 SV=1
13	AFDB:Q9VNP8	0.461	0.335	3.624E-10	438	0.166	0.116	Q9VNP8.pdb.gz	Q9VNP8_DROME General transcription factor IIH subunit OS=Drosophila melanogaster OX=7227 GN=Ssl1 PE=1 SV=2
14	PDB:6gym6	0.458	0.424	3.731E-10	335	0.123	0.113	6gym6.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
15	PDB:7zs96	0.448	0.369	5.435E-10	383	0.120	0.097	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
16	PDB:7ad8D	0.436	0.473	7.916E-10	280	0.149	0.164	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
17	AFDB:O74995	0.455	0.343	1.737E-9	421	0.140	0.102	O74995.pdb.gz	TFH47_SCHPO General transcription and DNA repair factor IIH subunit ssl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssl1 PE=1 SV=1
18	PDB:7ena2	0.438	0.361	1.291E-6	385	0.143	0.114	7ena2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:6orbA	0.438	0.049	1.658E-6	3352	0.091	0.008	6orbA.pdb.gz
20	PDB:6zgaB	0.392	0.178	2.415E-6	786	0.101	0.039	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5GWD3	0.0	520	258	0.838	1.000	F5GWD3_HUMAN General transcription factor IIH subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=GTF2H3 PE=1 SV=1
2	Q13889	0.0	638	308	1.000	1.000	TF2H3_HUMAN General transcription factor IIH subunit 3 OS=Homo sapiens OX=9606 GN=GTF2H3 PE=1 SV=2
3	F5H4K7	6.20e-139	393	210	0.633	0.929	F5H4K7_HUMAN General transcription factor IIH subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=GTF2H3 PE=1 SV=1
4	H0YFF7	2.35e-138	390	194	0.630	1.000	H0YFF7_HUMAN General transcription factor IIH subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=GTF2H3 PE=1 SV=1
5	F5GXG6	1.21e-127	363	177	0.565	0.983	F5GXG6_HUMAN General transcription factor IIH subunit 3 (Fragment) OS=Homo sapiens OX=9606 GN=GTF2H3 PE=1 SV=1
6	A0A087WYD5	4.86e-117	335	162	0.526	1.000	A0A087WYD5_HUMAN General transcription factor IIH subunit 3 OS=Homo sapiens OX=9606 GN=GTF2H3 PE=1 SV=1
7	O74366	1.14e-61	199	297	0.347	0.360	TFB4_SCHPO General transcription and DNA repair factor IIH subunit tfb4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfb4 PE=1 SV=1
8	Q12004	1.12e-39	144	338	0.318	0.290	TFB4_YEAST General transcription and DNA repair factor IIH subunit TFB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFB4 PE=1 SV=1
9	Q8IEG6	0.003	41.2	401	0.101	0.077	Q8IEG6_PLAF7 General transcription factor IIH subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1314900 PE=3 SV=1
10	Q9ZVN9	0.10	36.6	421	0.185	0.135	TF2H2_ARATH General transcription factor IIH subunit 2 OS=Arabidopsis thaliana OX=3702 GN=GTF2H2 PE=1 SV=1
11	Q04673	0.76	33.9	461	0.045	0.030	SSL1_YEAST General transcription and DNA repair factor IIH subunit SSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSL1 PE=1 SV=1
12	P38286	2.6	32.0	347	0.078	0.069	MKAR_YEAST Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IFA38 PE=1 SV=1
13	Q2UD93	2.9	32.3	971	0.084	0.027	XLNR_ASPOR Xylanolytic transcriptional activator xlnR OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xlnR PE=1 SV=2
14	Q8C6K9	3.2	32.0	2265	0.042	0.006	CO6A6_MOUSE Collagen alpha-6(VI) chain OS=Mus musculus OX=10090 GN=Col6a6 PE=1 SV=2
15	Q06139	3.8	30.0	101	0.039	0.119	CIS1_YEAST Citrinin resistance protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CIS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03850 Tfb4	2.7e-103	356.9	Transcription factor Tfb4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445162

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256443	0.999	Cyclin-dependent kinase 7
2	9606.ENSP00000256897	0.999	Cyclin-H
3	9606.ENSP00000259895	0.999	General transcription factor IIH subunit 4
4	9606.ENSP00000261245	0.999	CDK-activating kinase assembly factor MAT1
5	9606.ENSP00000265963	0.999	General transcription factor IIH subunit 1
6	9606.ENSP00000285398	0.999	TFIIH basal transcription factor complex helicase XPB subunit
7	9606.ENSP00000328901	0.999	General transcription factor IIH subunit 2
8	9606.ENSP00000375809	0.999	TFIIH basal transcription factor complex helicase XPD subunit
9	9606.ENSP00000476100	0.999	General transcription factor IIH subunit 5
10	9606.ENSP00000348168	0.997	Transcription initiation factor IIE subunit beta
11	9606.ENSP00000283875	0.996	General transcription factor IIE subunit 1
12	9606.ENSP00000422907	0.996	General transcription factor IIH subunit 2-like protein
13	9606.ENSP00000359531	0.992	Transcription initiation factor IIB
14	9606.ENSP00000377969	0.988	General transcription factor IIF subunit 1
15	9606.ENSP00000375942	0.986	TATA-box-binding protein
16	9606.ENSP00000379372	0.986	Transcription initiation factor IIA subunit 2
17	9606.ENSP00000428426	0.983	Transcription elongation factor A protein 1
18	9606.ENSP00000452454	0.980	Transcription initiation factor IIA subunit 1
19	9606.ENSP00000364270	0.978	DNA repair protein complementing XP-A cells
20	9606.ENSP00000340823	0.962	General transcription factor IIF subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	1.000	RNA polymerase II general transcription initiation factor activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006366	0.985	transcription by RNA polymerase II
GO:0006281	0.969	DNA repair
GO:0050794	0.487	regulation of cellular process
GO:0019222	0.446	regulation of metabolic process
GO:0031323	0.443	regulation of cellular metabolic process
GO:0031326	0.416	regulation of cellular biosynthetic process
GO:0060255	0.367	regulation of macromolecule metabolic process
GO:0010468	0.305	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0140513	0.999	nuclear protein-containing complex
GO:1902494	0.997	catalytic complex
GO:0090575	0.989	RNA polymerase II transcription regulator complex
GO:0055029	0.985	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.984	RNA polymerase II, holoenzyme
GO:0005669	0.908	transcription factor TFIID complex
GO:0000439	0.906	transcription factor TFIIH core complex
GO:1902554	0.873	serine/threonine protein kinase complex
GO:0032806	0.852	carboxy-terminal domain protein kinase complex
GO:0005675	0.839	transcription factor TFIIH holo complex
GO:0043232	0.782	intracellular non-membrane-bounded organelle
GO:0032993	0.665	protein-DNA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]