StarFunc result for job id Q13905

User Input

>input (1077 residues)
MDTDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSVKIPEKPVNKEATDRFLPEG
YPLPLDLEQQAVEFMSTSAVASRSQRQKNLSWLEEKEKEVVSALRYFKTIVDKMAIDKKV
LEMLPGSASKVLEAILPLVQNDPRIQHSSALSSCYSRVYQSLANLIRWSDQVMLEGVNSE
DKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSSPASKPDGPAELPLTDRE
VEILNKTTGMSQSTELLPDATDEEVAPPKPPLPGIRVVDNSPPPALPPKKRQSAPSPTRV
AVVAPMSRATSGSSLPVGINRQDFDVDCYAQRRLSGGSHSYGGESPRLSPCSSIGKLSKS
DEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQIPQQTAWNLSPLPESLGE
SGSPFLGPPFQLPLGGHPQPDGPLAPGQQTDTPPALPEKKRRSAASQTADGSGCRVSYER
HPSQYDNISGEDLQSTAPIPSVPYAPFAAILPFQHGGSSAPVEFVGDFTAPESTGDPEKP
PPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQNEHIYQQKNKLLMEVYGFSDSFSGVD
SVQELAPPPALPPKQRQLEPPAGKDGHPRDPSAVSGVPGKDSRDGSERAPKSPDALESAQ
SEEEVDELSLIDHNEIMSRLTLKQEGDDGPDVRGGSGDILLVHATETDRKDLVLYCEAFL
TTYRTFISPEELIKKLQYRYEKFSPFADTFKKRVSKNTFFVLVRVVDELCLVELTEEILK
LLMELVFRLVCNGELSLARVLRKNILDKVDQKKLLRCATSSQPLAARGVAARPGTLHDFH
SHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQ
EKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSEGLAEYCTL
IDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRWQQFNILD
SMRCFQQAHYDMRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDREEKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A5F8MPI9	0.652	0.647	0.000	1087	0.920	0.912	A0A5F8MPI9.pdb.gz	A0A5F8MPI9_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
2	AFDB:Q3UHC1	0.670	0.595	0.000	1224	0.919	0.809	Q3UHC1.pdb.gz	Q3UHC1_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
3	PDB:2byvE	0.302	0.350	2.069E-13	922	0.091	0.106	2byvE.pdb.gz
4	PDB:4f7zA	0.299	0.339	2.700E-12	946	0.090	0.103	4f7zA.pdb.gz
5	AFDB:Q54L90	0.263	0.182	4.574E-9	1601	0.144	0.097	Q54L90.pdb.gz	GFLB_DICDI Ras guanine nucleotide exchange factor glfB OS=Dictyostelium discoideum OX=44689 GN=gflB PE=1 SV=1
6	AFDB:Q9R0I7	0.063	0.054	9.301E-4	1386	0.123	0.096	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
7	AFDB:Q9ZW06	0.084	0.089	3.281E-2	972	0.120	0.133	Q9ZW06.pdb.gz	PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana OX=3702 GN=APUM2 PE=1 SV=1
8	AFDB:Q8JZQ0	0.061	0.105	9.635E-2	566	0.081	0.154	Q8JZQ0.pdb.gz	CSF1_RAT Macrophage colony-stimulating factor 1 OS=Rattus norvegicus OX=10116 GN=Csf1 PE=1 SV=1
9	AFDB:Q8LL04	0.054	0.049	1.004E-1	1241	0.088	0.077	Q8LL04.pdb.gz	CPL3_ARATH RNA polymerase II C-terminal domain phosphatase-like 3 OS=Arabidopsis thaliana OX=3702 GN=CPL3 PE=1 SV=2
10	PDB:7sn8D	0.077	0.175	1.028E-1	399	0.042	0.113	7sn8D.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
11	AFDB:A0A1D8PFH4	0.086	0.067	1.137E-1	1466	0.136	0.100	A0A1D8PFH4.pdb.gz	A0A1D8PFH4_CANAL Spa2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPA2 PE=4 SV=1
12	AFDB:E5FYH1	0.069	0.053	1.137E-1	1653	0.119	0.077	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
13	AFDB:F4JCS8	0.062	0.046	1.399E-1	1613	0.113	0.076	F4JCS8.pdb.gz	F4JCS8_ARATH Protein SUO OS=Arabidopsis thaliana OX=3702 GN=SUO PE=1 SV=1
14	PDB:6bk8L	0.084	0.155	4.203E-1	412	0.048	0.126	6bk8L.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
15	PDB:7pgsN	0.085	0.054	5.618E-1	1787	0.046	0.028	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
16	PDB:7mp5A	0.090	0.067	6.630E-1	1629	0.047	0.031	7mp5A.pdb.gz
17	PDB:7r04B	0.092	0.056	7.508E-1	2229	0.054	0.026	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
18	PDB:3w3zA	0.089	0.093	9.236E-1	1013	0.047	0.050	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
19	PDB:7unkA	0.064	0.065	9.627E-1	1047	0.050	0.052	7unkA.pdb.gz
20	PDB:7n8oQ	0.073	0.420	1.046	119	0.012	0.109	7n8oQ.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5F8MPI9	0.0	1972	1087	0.920	0.912	A0A5F8MPI9_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
2	A0A8I5ZQV4	0.0	1911	1123	0.915	0.877	A0A8I5ZQV4_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=4 SV=1
3	A0A8I5ZRV1	0.0	1934	1112	0.915	0.886	A0A8I5ZRV1_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=4 SV=1
4	A0A8I5ZUL6	0.0	1846	1074	0.882	0.885	A0A8I5ZUL6_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=4 SV=1
5	A0A8I6A6H6	0.0	1026	1221	0.508	0.448	A0A8I6A6H6_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=4 SV=1
6	A1L338	0.0	919	1185	0.409	0.372	A1L338_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
7	F1M8L9	0.0	1026	1256	0.508	0.436	F1M8L9_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=1 SV=4
8	F6ZDE5	0.0	1085	643	0.510	0.854	F6ZDE5_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 (Fragment) OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
9	Q13905	0.0	2212	1077	1.000	1.000	RPGF1_HUMAN Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1 PE=1 SV=3
10	Q3UGX8	0.0	920	1218	0.414	0.366	Q3UGX8_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
11	Q3UHC1	0.0	1058	1224	0.511	0.449	Q3UHC1_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
12	Q8C5V7	0.0	1085	642	0.510	0.855	Q8C5V7_MOUSE Rap guanine nucleotide exchange factor 1 (Fragment) OS=Mus musculus OX=10090 GN=Rapgef1 PE=2 SV=1
13	Q91ZZ2	0.0	1974	1086	0.920	0.913	Q91ZZ2_MOUSE Guanine nucleotide exchange factor OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
14	Q9QYV3	0.0	1717	1013	0.825	0.878	Q9QYV3_RAT C3G protein (Fragment) OS=Rattus norvegicus OX=10116 GN=c3g PE=2 SV=1
15	O77086	9.36e-134	444	1571	0.207	0.142	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
16	Q54PQ4	1.18e-40	161	605	0.112	0.200	GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum OX=44689 GN=gefA PE=1 SV=1
17	Q8SSQ0	3.14e-39	161	1721	0.113	0.071	GEFR_DICDI Ras guanine nucleotide exchange factor R OS=Dictyostelium discoideum OX=44689 GN=gefR PE=1 SV=1
18	Q13972	8.77e-35	147	1273	0.084	0.071	RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens OX=9606 GN=RASGRF1 PE=1 SV=2
19	B0M0P8	1.68e-34	146	2356	0.111	0.051	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
20	G1TRT1	1.86e-33	142	1304	0.102	0.084	G1TRT1_RABIT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Oryctolagus cuniculus OX=9986 GN=SOS1 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00617 RasGEF	3.3e-50	182.3	RasGEF domain
2	PF00618 RasGEF_N	2.6e-06	39.0	RasGEF N-terminal motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361263

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300574	0.999	Adapter molecule crk
2	9606.ENSP00000346300	0.999	Crk-like protein
3	9606.ENSP00000264033	0.998	E3 ubiquitin-protein ligase CBL
4	9606.ENSP00000391669	0.993	Breast cancer anti-estrogen resistance protein 1
5	9606.ENSP00000261769	0.987	Cadherin-1
6	9606.ENSP00000358723	0.981	Ras-related protein Rap-1A
7	9606.ENSP00000421922	0.975	Alpha-2-macroglobulin receptor-associated protein
8	9606.ENSP00000362680	0.974	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000238738	0.973	Rho-related GTP-binding protein RhoQ
10	9606.ENSP00000407586	0.967	GTPase HRas
11	9606.ENSP00000250559	0.965	Ras-related protein Rap-1b
12	9606.ENSP00000376345	0.961	Growth factor receptor-bound protein 2
13	9606.ENSP00000346671	0.951	Tyrosine-protein kinase Fyn
14	9606.ENSP00000360293	0.946	Sorbin and SH3 domain-containing protein 1
15	9606.ENSP00000392423	0.946	Reelin
16	9606.ENSP00000354952	0.944	GRB2-associated-binding protein 2
17	9606.ENSP00000303634	0.941	Low-density lipoprotein receptor-related protein 8
18	9606.ENSP00000400175	0.941	Transforming protein RhoA
19	9606.ENSP00000256078	0.939	GTPase KRas
20	9606.ENSP00000341189	0.939	Focal adhesion kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0007154	0.989	cell communication
GO:0023052	0.988	signaling
GO:0070372	0.973	regulation of ERK1 and ERK2 cascade
GO:0007165	0.972	signal transduction
GO:0048518	0.946	positive regulation of biological process
GO:0048522	0.943	positive regulation of cellular process
GO:0051128	0.938	regulation of cellular component organization
GO:0048856	0.919	anatomical structure development
GO:0007265	0.919	Ras protein signal transduction
GO:0007169	0.919	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0070374	0.883	positive regulation of ERK1 and ERK2 cascade
GO:0031344	0.872	regulation of cell projection organization
GO:0048008	0.870	platelet-derived growth factor receptor signaling pathway
GO:0043547	0.865	positive regulation of GTPase activity
GO:0032501	0.862	multicellular organismal process
GO:0051896	0.858	regulation of protein kinase B signaling
GO:0048519	0.857	negative regulation of biological process
GO:0048523	0.839	negative regulation of cellular process
GO:0043491	0.839	protein kinase B signaling
GO:0090630	0.830	activation of GTPase activity
GO:0042127	0.824	regulation of cell population proliferation
GO:0051898	0.808	negative regulation of protein kinase B signaling
GO:0120035	0.793	regulation of plasma membrane bounded cell projection organization
GO:0198738	0.785	cell-cell signaling by wnt
GO:2000177	0.780	regulation of neural precursor cell proliferation
GO:0051130	0.749	positive regulation of cellular component organization
GO:0051056	0.738	regulation of small GTPase mediated signal transduction
GO:0007275	0.731	multicellular organism development
GO:0008285	0.705	negative regulation of cell population proliferation
GO:0031346	0.692	positive regulation of cell projection organization
GO:0032879	0.672	regulation of localization
GO:0010975	0.651	regulation of neuron projection development
GO:2000178	0.649	negative regulation of neural precursor cell proliferation
GO:0000165	0.638	MAPK cascade
GO:0010976	0.622	positive regulation of neuron projection development
GO:0048731	0.603	system development
GO:0046578	0.587	regulation of Ras protein signal transduction
GO:0007155	0.575	cell adhesion
GO:0016055	0.553	Wnt signaling pathway
GO:0051058	0.516	negative regulation of small GTPase mediated signal transduction
GO:0098609	0.508	cell-cell adhesion
GO:0060070	0.502	canonical Wnt signaling pathway
GO:0046580	0.496	negative regulation of Ras protein signal transduction
GO:0008283	0.492	cell population proliferation
GO:0070373	0.489	negative regulation of ERK1 and ERK2 cascade
GO:0070371	0.472	ERK1 and ERK2 cascade
GO:0061351	0.467	neural precursor cell proliferation
GO:0090090	0.467	negative regulation of canonical Wnt signaling pathway
GO:0042221	0.432	response to chemical
GO:0002682	0.418	regulation of immune system process
GO:0001568	0.369	blood vessel development
GO:0002684	0.361	positive regulation of immune system process
GO:0070887	0.356	cellular response to chemical stimulus
GO:0080134	0.342	regulation of response to stress
GO:0051049	0.305	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0031410	0.999	cytoplasmic vesicle
GO:0005829	0.994	cytosol
GO:0012505	0.992	endomembrane system
GO:0032991	0.990	protein-containing complex
GO:0098588	0.987	bounding membrane of organelle
GO:0071944	0.945	cell periphery
GO:0005886	0.943	plasma membrane
GO:0030659	0.846	cytoplasmic vesicle membrane
GO:0030666	0.775	endocytic vesicle membrane
GO:0048471	0.766	perinuclear region of cytoplasm
GO:0030670	0.763	phagocytic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]