StarFunc result for job id Q13936

User Input

>input (2221 residues)
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQELVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDKSPYPNP
ETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVF
TSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVL
RVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSD
SSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPEL
LYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNC
ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQH
YGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVIL
SETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFR
VMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTE
INRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFA
VFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRI
KTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFK
KRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASE
DDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDST
FTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSPAIRVQEVAWKLS
SNRERHVPMCEDLELRRDSGSAGTQAHCLLLRKANPSRCHSRESQAAMAGQEETSQDETY
EVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRA
SFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPA
TPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLM
VPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESA
ADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSS
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5gjwA	0.559	0.951	0.000	1291	0.455	0.783	5gjwA.pdb.gz	Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
2	PDB:7jpxA	0.491	0.972	0.000	1116	0.393	0.781	7jpxA.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
3	PDB:7uhfA	0.540	0.968	0.000	1230	0.465	0.840	7uhfA.pdb.gz	Structural basis for pore blockade of human voltage-gated calcium channel Ca v 1.3 by motion sickness drug cinnarizine.
4	AFDB:A0A0R4IFN9	0.613	0.588	0.000	2319	0.375	0.359	A0A0R4IFN9.pdb.gz
5	AFDB:A0A0R4IQX8	0.651	0.694	0.000	2082	0.626	0.668	A0A0R4IQX8.pdb.gz
6	AFDB:F1R736	0.632	0.751	0.000	1859	0.529	0.632	F1R736.pdb.gz
7	AFDB:P07293	0.653	0.772	0.000	1873	0.539	0.640	P07293.pdb.gz	CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1
8	AFDB:P15381	0.690	0.706	0.000	2171	0.913	0.934	P15381.pdb.gz	CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus OX=9986 GN=CACNA1C PE=1 SV=1
9	AFDB:P27732	0.685	0.691	0.000	2203	0.647	0.652	P27732.pdb.gz	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
10	AFDB:P27884	0.609	0.559	0.000	2424	0.379	0.347	P27884.pdb.gz	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
11	AFDB:Q00975	0.615	0.585	0.000	2339	0.380	0.361	Q00975.pdb.gz	CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1
12	AFDB:Q13936	1.000	1.000	0.000	2221	1.000	1.000	Q13936.pdb.gz	CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens OX=9606 GN=CACNA1C PE=1 SV=4
13	AFDB:Q24270	0.643	0.569	0.000	2516	0.475	0.420	Q24270.pdb.gz	CAC1D_DROME Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1D PE=1 SV=2
14	PDB:7vfsA	0.530	0.914	3.293E-94	1266	0.302	0.530	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
15	PDB:7mixA	0.540	0.892	1.115E-92	1326	0.316	0.529	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
16	PDB:3jbrA	0.438	0.763	3.903E-74	1224	0.381	0.692	3jbrA.pdb.gz
17	PDB:7w9lA	0.469	0.713	1.298E-59	1420	0.182	0.285	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
18	PDB:7wliA	0.443	0.842	2.506E-56	1135	0.172	0.337	7wliA.pdb.gz	Structure, gating, and pharmacology of human Ca V 3.3 channel.
19	PDB:7xveA	0.449	0.756	7.431E-56	1276	0.172	0.299	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
20	PDB:7we4A	0.428	0.823	1.052E-55	1122	0.155	0.307	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZMH8	1258	1960	0.282	0.319	A0A8I5ZMH8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
2	A0A8I5ZS49	2182	1973	0.511	0.576	A0A8I5ZS49_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
3	A1XIQ4	2185	1980	0.512	0.575	A1XIQ4_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=2 SV=1
4	F8W3Z0	720	2280	0.176	0.171	F8W3Z0_DANRE Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b OS=Danio rerio OX=7955 GN=CACNA1Ab PE=2 SV=2
5	G3V9W8	2185	1980	0.512	0.575	G3V9W8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
6	G5EFB0	1208	1523	0.324	0.472	G5EFB0_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-2 PE=3 SV=2
7	G5EG02	1112	1783	0.269	0.335	G5EG02_CAEEL Voltage-dependent L-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=egl-19 PE=1 SV=1
8	O00555	655	2506	0.158	0.140	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
9	O35505	4138	2169	0.909	0.930	CAC1C_CAVPO Voltage-dependent L-type calcium channel subunit alpha-1C OS=Cavia porcellus OX=10141 GN=CACNA1C PE=1 SV=2
10	O55017	645	2327	0.163	0.156	CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus OX=10090 GN=Cacna1b PE=1 SV=1
11	O60840	2164	1977	0.518	0.582	CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens OX=9606 GN=CACNA1F PE=1 SV=2
12	O89089	640	2333	0.163	0.156	O89089_RAT Voltage-dependent N-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1b PE=1 SV=1
13	P07293	2314	1873	0.535	0.635	CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1
14	P15381	4138	2171	0.910	0.930	CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus OX=9986 GN=CACNA1C PE=1 SV=1
15	P22002	4093	2169	0.902	0.923	CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus OX=10116 GN=Cacna1c PE=1 SV=1
16	P27732	2442	2203	0.595	0.600	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
17	P27884	662	2424	0.165	0.151	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
18	P54282	649	2212	0.157	0.157	CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
19	P91645	1335	1851	0.347	0.416	CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=cac PE=1 SV=3
20	P97445	654	2368	0.156	0.146	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16885 CAC1F_C	3.4e-28	110.6	Voltage-gated calcium channel subunit alpha, C-term
2	PF08763 Ca_chan_IQ	7e-26	101.6	Voltage gated calcium channel IQ domain
3	PF16905 GPHH	5.9e-26	101.4	Voltage-dependent L-type calcium channel, IQ-associated
4	PF00520 Ion_trans	3e-261	873.3	Ion transport protein
5	PF08016 PKD_channel	1e-09	49.7	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008972046.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003811485.1	0.996	Voltage-dependent L-type calcium channel subunit beta-2 isoform X1
2	9597.XP_003818778.1	0.971	Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death
3	9597.XP_003817536.1	0.968	Belongs to the calmodulin family.
4	9597.XP_008965970.1	0.948	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
5	9597.XP_003825857.1	0.933	Calcium voltage-gated channel auxiliary subunit beta 3
6	9597.XP_003809882.1	0.905	Calcium voltage-gated channel auxiliary subunit beta 1
7	9597.XP_003822789.1	0.902	Voltage-dependent calcium channel subunit alpha-2/delta-1 isoform X1
8	9597.XP_003828060.1	0.878	Calmodulin-like protein 4 isoform X1
9	9597.XP_008963824.1	0.873	Potassium calcium-activated channel subfamily M alpha 1
10	9597.XP_008970452.1	0.862	Voltage-dependent calcium channel subunit alpha-2/delta-2 isoform X1
11	9597.XP_003832316.1	0.859	Protein kinase, cGMP-dependent, type II
12	9597.XP_008974499.1	0.849	Calmodulin
13	9597.XP_003829994.1	0.848	Protein phosphatase 3 catalytic subunit alpha
14	9597.XP_003832698.1	0.847	Nitric oxide synthase, brain
15	9597.XP_003807343.1	0.845	Calmodulin like 6
16	9597.XP_003832521.1	0.845	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
17	9597.XP_003827833.1	0.844	Calmodulin like 5
18	9597.XP_003827834.1	0.844	Belongs to the calmodulin family.
19	9597.XP_008976452.1	0.843	Ryanodine receptor 2
20	9597.XP_008967260.1	0.842	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0005515	0.999	protein binding
GO:0008331	0.947	high voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050789	0.994	regulation of biological process
GO:0009987	0.993	cellular process
GO:0006816	0.985	calcium ion transport
GO:0050896	0.975	response to stimulus
GO:0050794	0.958	regulation of cellular process
GO:0044057	0.952	regulation of system process
GO:1903522	0.942	regulation of blood circulation
GO:0055085	0.942	transmembrane transport
GO:0032501	0.941	multicellular organismal process
GO:0007154	0.936	cell communication
GO:0003012	0.933	muscle system process
GO:0008016	0.931	regulation of heart contraction
GO:0098660	0.930	inorganic ion transmembrane transport
GO:0061337	0.921	cardiac conduction
GO:0086065	0.882	cell communication involved in cardiac conduction
GO:0098662	0.881	inorganic cation transmembrane transport
GO:0034220	0.881	monoatomic ion transmembrane transport
GO:0042391	0.869	regulation of membrane potential
GO:0098655	0.866	monoatomic cation transmembrane transport
GO:0034762	0.857	regulation of transmembrane transport
GO:0010959	0.855	regulation of metal ion transport
GO:0034765	0.852	regulation of monoatomic ion transmembrane transport
GO:1904062	0.842	regulation of monoatomic cation transmembrane transport
GO:0048856	0.828	anatomical structure development
GO:0048518	0.778	positive regulation of biological process
GO:0006936	0.778	muscle contraction
GO:0023052	0.776	signaling
GO:0051716	0.774	cellular response to stimulus
GO:0051924	0.771	regulation of calcium ion transport
GO:0070509	0.766	calcium ion import
GO:0070588	0.740	calcium ion transmembrane transport
GO:0007275	0.739	multicellular organism development
GO:1903169	0.726	regulation of calcium ion transmembrane transport
GO:0007165	0.688	signal transduction
GO:0048731	0.659	system development
GO:0001508	0.649	action potential
GO:0086001	0.604	cardiac muscle cell action potential
GO:0051899	0.456	membrane depolarization
GO:0048513	0.420	animal organ development
GO:0035556	0.367	intracellular signal transduction
GO:0042221	0.321	response to chemical
GO:0065009	0.317	regulation of molecular function
GO:0048522	0.314	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034703	0.998	cation channel complex
GO:0098797	0.997	plasma membrane protein complex
GO:0034704	0.989	calcium channel complex
GO:0005891	0.981	voltage-gated calcium channel complex
GO:0042383	0.933	sarcolemma
GO:0030315	0.909	T-tubule
GO:0043229	0.740	intracellular organelle
GO:0005737	0.677	cytoplasm
GO:0043227	0.508	membrane-bounded organelle
GO:0030054	0.384	cell junction
GO:0045202	0.330	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]