StarFunc result for job id Q13951

User Input

>input (182 residues)
MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLD
GMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTT
RP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08024	0.932	0.907	2.698E-32	187	0.907	0.882	Q08024.pdb.gz	PEBB_MOUSE Core-binding factor subunit beta OS=Mus musculus OX=10090 GN=Cbfb PE=1 SV=1
2	AFDB:A0A0B4P4E8	0.907	0.824	1.810E-29	201	0.824	0.746	A0A0B4P4E8.pdb.gz
3	AFDB:Q24040	0.814	0.702	7.939E-22	213	0.473	0.404	Q24040.pdb.gz	BGB_DROME Protein big brother OS=Drosophila melanogaster OX=7227 GN=Bgb PE=2 SV=3
4	PDB:6p59A	0.533	0.602	4.559E-21	157	0.791	0.917	6p59A.pdb.gz	Structural Basis for a Species-Specific Determinant of an SIV Vif Protein toward Hominid APOBEC3G Antagonism.
5	AFDB:A0A0B4PJ32	0.733	0.835	5.393E-20	158	0.659	0.759	A0A0B4PJ32.pdb.gz
6	AFDB:Q24039	0.711	0.612	5.393E-20	213	0.456	0.390	Q24039.pdb.gz	BRO_DROME Protein brother OS=Drosophila melanogaster OX=7227 GN=Bro PE=1 SV=2
7	AFDB:Q95ZL9	0.569	0.679	1.707E-10	152	0.176	0.211	Q95ZL9.pdb.gz	PEBB_CAEEL Core-binding factor subunit beta homolog bro-1 OS=Caenorhabditis elegans OX=6239 GN=bro-1 PE=1 SV=1
8	AFDB:A0A0B4P589	0.380	0.726	4.755E-10	94	0.401	0.777	A0A0B4P589.pdb.gz
9	AFDB:A0A0B4P508	0.260	0.764	4.683E-4	60	0.148	0.450	A0A0B4P508.pdb.gz
10	AFDB:Q38CF5	0.205	0.046	4.299E-2	1502	0.121	0.015	Q38CF5.pdb.gz	Q38CF5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7300 PE=4 SV=1
11	AFDB:B5BM46	0.168	0.064	1.351E-1	682	0.132	0.035	B5BM46.pdb.gz	B5BM46_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=num-1 PE=1 SV=1
12	PDB:4gwpF	0.133	0.119	2.622E-1	209	0.093	0.081	4gwpF.pdb.gz
13	PDB:7acj5	0.135	0.158	3.337E-1	150	0.115	0.140	7acj5.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
14	PDB:3ggrB	0.147	0.105	3.764E-1	278	0.071	0.047	3ggrB.pdb.gz
15	PDB:4runB	0.148	0.171	4.790E-1	152	0.099	0.118	4runB.pdb.gz
16	PDB:2qo5A	0.144	0.182	5.088E-1	129	0.066	0.093	2qo5A.pdb.gz
17	PDB:5t43A	0.122	0.136	5.404E-1	158	0.044	0.051	5t43A.pdb.gz
18	PDB:2jmuA	0.144	0.122	5.740E-1	224	0.077	0.062	2jmuA.pdb.gz
19	PDB:3bhdA	0.164	0.146	5.740E-1	211	0.099	0.085	3bhdA.pdb.gz
20	PDB:6drtA	0.132	0.113	7.304E-1	230	0.093	0.074	6drtA.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13951	4.27e-134	374	182	1.000	1.000	PEBB_HUMAN Core-binding factor subunit beta OS=Homo sapiens OX=9606 GN=CBFB PE=1 SV=2
2	E1B9S8	2.22e-133	372	182	0.995	0.995	E1B9S8_BOVIN Core-binding factor subunit beta OS=Bos taurus OX=9913 GN=CBFB PE=3 SV=2
3	Q66HA7	3.80e-132	369	182	0.984	0.984	Q66HA7_RAT Core-binding factor subunit beta OS=Rattus norvegicus OX=10116 GN=Cbfb PE=1 SV=1
4	A0A8I6GMB2	2.82e-120	339	186	0.907	0.887	A0A8I6GMB2_RAT Core-binding factor subunit beta OS=Rattus norvegicus OX=10116 GN=Cbfb PE=3 SV=1
5	Q08024	2.92e-120	339	187	0.907	0.882	PEBB_MOUSE Core-binding factor subunit beta OS=Mus musculus OX=10090 GN=Cbfb PE=1 SV=1
6	A0A0B4PIS7	8.23e-112	318	187	0.819	0.797	A0A0B4PIS7_DANRE Core binding factor beta subunit isoform 9 OS=Danio rerio OX=7955 GN=unp1266 PE=2 SV=1
7	Q98U16	1.11e-110	315	187	0.819	0.797	Q98U16_DANRE Core binding factor B subunit OS=Danio rerio OX=7955 GN=CBFB PE=2 SV=1
8	A0A140LGT1	2.37e-110	315	201	0.808	0.731	A0A140LGT1_DANRE Core-binding factor subunit beta OS=Danio rerio OX=7955 GN=unp1266 PE=3 SV=1
9	A0A0B4P4A4	4.77e-110	313	188	0.808	0.782	A0A0B4P4A4_DANRE Core binding factor beta subunit isoform 1 OS=Danio rerio OX=7955 GN=unp1266 PE=2 SV=1
10	A0A0B4P506	5.18e-110	313	174	0.813	0.851	A0A0B4P506_DANRE Core binding factor beta subunit isoform 2 OS=Danio rerio OX=7955 GN=unp1266 PE=2 SV=1
11	A0A8I5ZT73	2.99e-96	277	154	0.720	0.851	A0A8I5ZT73_RAT Core-binding factor subunit beta OS=Rattus norvegicus OX=10116 GN=Cbfb PE=3 SV=1
12	A0A8I6AB92	1.25e-81	240	147	0.692	0.857	A0A8I6AB92_RAT Core-binding factor subunit beta OS=Rattus norvegicus OX=10116 GN=Cbfb PE=1 SV=1
13	Q24040	2.27e-57	181	213	0.473	0.404	BGB_DROME Protein big brother OS=Drosophila melanogaster OX=7227 GN=Bgb PE=2 SV=3
14	Q24039	6.03e-52	167	213	0.462	0.394	BRO_DROME Protein brother OS=Drosophila melanogaster OX=7227 GN=Bro PE=1 SV=2
15	Q95ZL9	6.36e-06	46.2	152	0.170	0.204	PEBB_CAEEL Core-binding factor subunit beta homolog bro-1 OS=Caenorhabditis elegans OX=6239 GN=bro-1 PE=1 SV=1
16	Q93Y12	0.96	32.3	991	0.066	0.012	Q93Y12_ARATH Alpha glucosidase-like protein OS=Arabidopsis thaliana OX=3702 GN=HGL1 PE=1 SV=1
17	Q96QB1	2.3	31.2	1528	0.104	0.012	RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens OX=9606 GN=DLC1 PE=1 SV=4
18	C0H4K6	3.9	30.4	3893	0.082	0.004	C0H4K6_PLAF7 E3 ubiquitin-protein ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0704600 PE=4 SV=1
19	Q5JTZ5	6.7	29.3	239	0.104	0.079	CI152_HUMAN Uncharacterized protein C9orf152 OS=Homo sapiens OX=9606 GN=C9orf152 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02312 CBF_beta	7e-82	284.6	Core binding factor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000013055

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000012850	0.991	Runt-related transcription factor 2
2	9555.ENSPANP00000013024	0.990	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'- TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX
3	9555.ENSPANP00000008083	0.975	Cullin 5
4	9555.ENSPANP00000004959	0.953	Transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
5	9555.ENSPANP00000017567	0.947	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'- TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX
6	9555.ENSPANP00000001213	0.884	annotation not available
7	9555.ENSPANP00000013739	0.884	Elongin B
8	9555.ENSPANP00000013357	0.766	Chromobox homolog 7
9	9555.ENSPANP00000013346	0.764	Chromobox homolog 6
10	9555.ENSPANP00000010592	0.706	ETS proto-oncogene 1, transcription factor
11	9555.ENSPANP00000010782	0.706	Fli-1 proto-oncogene, ETS transcription factor
12	9555.ENSPANP00000012979	0.693	ERG, ETS transcription factor
13	9555.ENSPANP00000006643	0.660	Mothers against decapentaplegic homolog
14	9555.ENSPANP00000014165	0.655	Mothers against decapentaplegic homolog
15	9555.ENSPANP00000020415	0.650	Protein phosphatase, Mg2+/Mn2+ dependent, 1D
16	9555.ENSPANP00000016270	0.649	Chromobox homolog 2
17	9555.ENSPANP00000017438	0.648	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
18	9555.ENSPANP00000016273	0.645	Chromobox homolog 4
19	9555.ENSPANP00000020139	0.642	Cullin 2
20	9555.ENSPANP00000017046	0.639	MNAT CDK-activating kinase assembly factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140110	1.000	transcription regulator activity
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:0003712	0.977	transcription coregulator activity
GO:0046982	0.921	protein heterodimerization activity
GO:0043565	0.365	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0050789	0.943	regulation of biological process
GO:0010468	0.923	regulation of gene expression
GO:0071704	0.842	organic substance metabolic process
GO:0044237	0.835	cellular metabolic process
GO:0044238	0.834	primary metabolic process
GO:0006807	0.817	nitrogen compound metabolic process
GO:0043170	0.812	macromolecule metabolic process
GO:0032774	0.781	RNA biosynthetic process
GO:0016567	0.727	protein ubiquitination
GO:0097659	0.694	nucleic acid-templated transcription
GO:0000209	0.671	protein polyubiquitination
GO:0006351	0.655	DNA-templated transcription
GO:0050794	0.595	regulation of cellular process
GO:0006366	0.477	transcription by RNA polymerase II
GO:0031323	0.431	regulation of cellular metabolic process
GO:0080090	0.430	regulation of primary metabolic process
GO:0051171	0.429	regulation of nitrogen compound metabolic process
GO:0006357	0.423	regulation of transcription by RNA polymerase II
GO:0032502	0.358	developmental process
GO:0048856	0.319	anatomical structure development
GO:0048518	0.312	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.999	protein-containing complex
GO:0031974	0.998	membrane-enclosed lumen
GO:0016020	0.988	membrane
GO:0005654	0.966	nucleoplasm
GO:0005667	0.948	transcription regulator complex
GO:0016513	0.943	core-binding factor complex
GO:0005737	0.722	cytoplasm
GO:0043232	0.339	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]