StarFunc result for job id Q13952

User Input

>input (458 residues)
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKM
ISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
DELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIII
AQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIP
VQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRRCLKETLQITQTE
VQQGQQQFSQFTDGQRNSVQQARVSELTGEAEPREVKATGNSTPCTSSLPTTHPPSHRAG
ASCVCCSQPQQSSTSPPPSDALQWVVVEVSGTPNQLETHRELHAPLPGMTSLSPLHPSQQ
LYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13952	1.000	1.000	3.337E-69	458	1.000	1.000	Q13952.pdb.gz	NFYC_HUMAN Nuclear transcription factor Y subunit gamma OS=Homo sapiens OX=9606 GN=NFYC PE=1 SV=3
2	AFDB:P70353	0.381	0.493	8.478E-41	335	0.699	0.955	P70353.pdb.gz	NFYC_MOUSE Nuclear transcription factor Y subunit gamma OS=Mus musculus OX=10090 GN=Nfyc PE=1 SV=2
3	AFDB:Q7ZVY3	0.327	0.403	9.720E-35	360	0.539	0.686	Q7ZVY3.pdb.gz	Q7ZVY3_DANRE Nfyc protein OS=Danio rerio OX=7955 GN=fb98f01 PE=1 SV=1
4	AFDB:Q9GSP1	0.176	0.235	1.984E-5	341	0.118	0.158	Q9GSP1.pdb.gz	Q9GSP1_DROME LD24434p OS=Drosophila melanogaster OX=7227 GN=NC2alpha PE=1 SV=1
5	PDB:5y26B	0.167	0.793	6.398E-5	92	0.059	0.293	5y26B.pdb.gz
6	PDB:1id3C	0.172	0.611	2.825E-3	110	0.041	0.173	1id3C.pdb.gz	Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
7	PDB:5y27A	0.167	0.701	4.396E-3	98	0.037	0.173	5y27A.pdb.gz
8	PDB:5z30G	0.155	0.559	1.459E-2	110	0.039	0.164	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
9	PDB:2rvqC	0.147	0.445	2.130E-2	133	0.050	0.173	2rvqC.pdb.gz
10	PDB:6wjv4	0.145	0.552	2.921E-2	107	0.031	0.131	6wjv4.pdb.gz
11	AFDB:Q54GH3	0.092	0.070	3.201E-2	663	0.172	0.119	Q54GH3.pdb.gz	TOM1_DICDI Target of Myb protein 1 OS=Dictyostelium discoideum OX=44689 GN=tom1 PE=1 SV=1
12	PDB:6e0cA	0.141	0.605	3.530E-2	99	0.037	0.172	6e0cA.pdb.gz	Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.
13	PDB:6wjv3	0.159	0.742	4.005E-2	85	0.052	0.282	6wjv3.pdb.gz
14	PDB:7egdF	0.147	0.162	4.266E-2	412	0.041	0.046	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
15	PDB:7ktsF	0.133	0.171	4.266E-2	351	0.046	0.060	7ktsF.pdb.gz
16	AFDB:Q581A4	0.085	0.060	3.107E-1	741	0.138	0.085	Q581A4.pdb.gz	Q581A4_TRYB2 C2 NT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.430 PE=4 SV=1
17	AFDB:D2X8A0	0.068	0.051	3.310E-1	708	0.068	0.044	D2X8A0.pdb.gz
18	AFDB:Q63717	0.073	0.075	5.485E-1	448	0.107	0.109	Q63717.pdb.gz	Q63717_RAT Heat shock transcription factor 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=2 SV=1
19	AFDB:Q8IM96	0.073	0.057	5.842E-1	647	0.129	0.091	Q8IM96.pdb.gz	Q8IM96_DROME Shaven, isoform C OS=Drosophila melanogaster OX=7227 GN=sv PE=4 SV=3
20	AFDB:O13166	0.080	0.054	6.223E-1	761	0.133	0.080	O13166.pdb.gz	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13952	0.0	916	458	1.000	1.000	NFYC_HUMAN Nuclear transcription factor Y subunit gamma OS=Homo sapiens OX=9606 GN=NFYC PE=1 SV=3
2	P70353	5.30e-171	485	335	0.644	0.881	NFYC_MOUSE Nuclear transcription factor Y subunit gamma OS=Mus musculus OX=10090 GN=Nfyc PE=1 SV=2
3	Q62725	5.38e-170	483	335	0.644	0.881	NFYC_RAT Nuclear transcription factor Y subunit gamma OS=Rattus norvegicus OX=10116 GN=Nfyc PE=2 SV=1
4	Q7ZVY3	1.49e-144	419	360	0.520	0.661	Q7ZVY3_DANRE Nfyc protein OS=Danio rerio OX=7955 GN=fb98f01 PE=1 SV=1
5	Q6P0F1	9.95e-142	412	359	0.517	0.660	Q6P0F1_DANRE Nuclear transcription factor Y subunit gamma isoform X2 OS=Danio rerio OX=7955 GN=fb98f01 PE=1 SV=1
6	H0Y803	2.82e-93	281	186	0.334	0.823	H0Y803_HUMAN Nuclear transcription factor Y subunit gamma (Fragment) OS=Homo sapiens OX=9606 GN=NFYC PE=1 SV=1
7	Q16247	7.80e-73	233	304	0.393	0.592	Q16247_HUMAN Histone H1 transcription factor large subunit 2A OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q8LCG7	6.35e-47	162	199	0.166	0.382	NFYC2_ARATH Nuclear transcription factor Y subunit C-2 OS=Arabidopsis thaliana OX=3702 GN=NFYC2 PE=1 SV=2
9	Q655V5	4.91e-45	159	250	0.186	0.340	NFYC4_ORYSJ Nuclear transcription factor Y subunit C-4 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC4 PE=1 SV=1
10	Q9SMP0	7.65e-44	155	234	0.170	0.333	NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana OX=3702 GN=NFYC1 PE=1 SV=1
11	Q9W3V9	2.61e-43	162	601	0.148	0.113	Q9W3V9_DROME Nuclear factor Y-box C OS=Drosophila melanogaster OX=7227 GN=Nf-YC PE=1 SV=1
12	O59849	2.74e-43	155	265	0.146	0.253	O59849_ASPOZ HAPE OS=Aspergillus oryzae OX=5062 GN=hapE PE=4 SV=1
13	Q9FMV5	6.73e-43	154	250	0.175	0.320	NFYC4_ARATH Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana OX=3702 GN=NFYC4 PE=1 SV=1
14	C8V0B5	9.11e-43	154	265	0.146	0.253	C8V0B5_EMENI HapE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06492 PE=1 SV=1
15	Q9ZVL3	2.24e-42	151	217	0.151	0.318	NFYC3_ARATH Nuclear transcription factor Y subunit C-3 OS=Arabidopsis thaliana OX=3702 GN=NFYC3 PE=1 SV=1
16	A0A1D8PN26	6.75e-42	154	348	0.148	0.195	A0A1D8PN26_CANAL Hap5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAP5 PE=4 SV=1
17	A6BLW4	1.32e-41	150	246	0.146	0.272	NFYC2_ORYSJ Nuclear transcription factor Y subunit C-2 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC2 PE=1 SV=1
18	Q8L4B2	2.84e-41	149	231	0.148	0.294	NFYC9_ARATH Nuclear transcription factor Y subunit C-9 OS=Arabidopsis thaliana OX=3702 GN=NFYC9 PE=1 SV=1
19	Q9XE33	1.09e-35	133	205	0.135	0.302	NFYC6_ORYSJ Nuclear transcription factor Y subunit C-6 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYC6 PE=1 SV=1
20	Q02516	1.53e-35	134	242	0.135	0.256	HAP5_YEAST Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAP5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	7.1e-12	56.7	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF09415 CENP-X	2.1e+02	13.6	CENP-S associating Centromere protein X
3	PF00122 E1-E2_ATPase	91	14.0	E1-E2 ATPase
4	PF00125 Histone	1.3e-12	59.5	Core histone H2A/H2B/H3/H4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008966664.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003833372.1	0.996	Nuclear transcription factor Y subunit alpha
2	9597.XP_003832611.1	0.993	Nuclear transcription factor Y subunit beta
3	9597.XP_008977026.1	0.990	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
4	9597.XP_003833116.1	0.927	DNA polymerase epsilon 3, accessory subunit
5	9597.XP_003820503.1	0.848	Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity).
6	9597.XP_003810114.1	0.827	Acts as a tumor suppressor in many tumor types
7	9597.XP_008955363.1	0.760	DNA polymerase epsilon subunit 2 isoform X1
8	9597.XP_003815096.1	0.719	Replication initiator 1
9	9597.XP_003811470.1	0.696	RB transcriptional corepressor 1
10	9597.XP_008964696.1	0.665	Huntingtin-associated protein 1 isoform X1
11	9597.XP_003824094.1	0.662	MYC associated factor X
12	9597.XP_003830123.1	0.662	Zinc finger and AT-hook domain containing
13	9597.XP_008965361.1	0.644	Rho guanine nucleotide exchange factor 10-like protein isoform X1
14	9597.XP_003818973.1	0.641	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
15	9597.XP_003820752.1	0.641	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
16	9597.XP_003825428.1	0.641	Helicase, lymphoid-specific
17	9597.XP_008959630.1	0.641	Chromodomain helicase DNA binding protein 1 like
18	9597.XP_003821708.1	0.637	TATA-box binding protein
19	9597.XP_008958403.1	0.629	Belongs to the histone H2B family.
20	9597.XP_003824651.1	0.628	Adenylate cyclase type 10 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.966	regulation of cellular process
GO:0009987	0.965	cellular process
GO:0045893	0.948	positive regulation of DNA-templated transcription
GO:0071704	0.904	organic substance metabolic process
GO:0006357	0.889	regulation of transcription by RNA polymerase II
GO:0044238	0.884	primary metabolic process
GO:0044237	0.846	cellular metabolic process
GO:0044260	0.744	cellular macromolecule metabolic process
GO:0006807	0.707	nitrogen compound metabolic process
GO:0018205	0.701	peptidyl-lysine modification
GO:0016570	0.685	histone modification
GO:0043414	0.673	macromolecule methylation
GO:0018022	0.645	peptidyl-lysine methylation
GO:0051568	0.640	histone H3-K4 methylation
GO:0032501	0.608	multicellular organismal process
GO:0032502	0.556	developmental process
GO:0007275	0.550	multicellular organism development
GO:0048731	0.458	system development
GO:0018023	0.458	peptidyl-lysine trimethylation
GO:0045944	0.301	positive regulation of transcription by RNA polymerase II
GO:0034641	0.300	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005667	0.999	transcription regulator complex
GO:0090575	0.949	RNA polymerase II transcription regulator complex
GO:0016602	0.936	CCAAT-binding factor complex
GO:0032993	0.921	protein-DNA complex
GO:0043232	0.459	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]