StarFunc result for job id Q13972

User Input

>input (1273 residues)
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERL
TDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLELLFASGQNN
KLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSN
GYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE
ESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSAL
SAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRH
WVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLE
EITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIM
KTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSA
IFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFI
EEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL
YESSLRIEPKLPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2X0SFL3	0.479	0.491	0.000	1237	0.645	0.664	A0A2X0SFL3.pdb.gz	A0A2X0SFL3_HUMAN RASGRF2 (Fragment) OS=Homo sapiens OX=9606 GN=RASGRF2 PE=4 SV=1
2	AFDB:P27671	0.519	0.522	0.000	1262	0.834	0.842	P27671.pdb.gz	RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus OX=10090 GN=Rasgrf1 PE=1 SV=2
3	AFDB:Q13972	1.000	1.000	0.000	1273	1.000	1.000	Q13972.pdb.gz	RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens OX=9606 GN=RASGRF1 PE=1 SV=2
4	AFDB:Q99JE4	0.354	0.378	0.000	1190	0.646	0.691	Q99JE4.pdb.gz	RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus OX=10116 GN=Rasgrf2 PE=1 SV=1
5	AFDB:P26675	0.315	0.256	6.871E-27	1596	0.145	0.115	P26675.pdb.gz	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
6	AFDB:Q54PQ4	0.231	0.468	7.268E-17	605	0.079	0.165	Q54PQ4.pdb.gz	GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum OX=44689 GN=gefA PE=1 SV=1
7	AFDB:Q8IS19	0.217	0.402	4.758E-15	668	0.067	0.127	Q8IS19.pdb.gz	GEFD_DICDI Ras guanine nucleotide exchange factor D OS=Dictyostelium discoideum OX=44689 GN=gefD PE=2 SV=1
8	AFDB:Q8IS16	0.210	0.423	3.396E-14	604	0.083	0.175	Q8IS16.pdb.gz	GEFH_DICDI Ras guanine nucleotide exchange factor H OS=Dictyostelium discoideum OX=44689 GN=gefH PE=1 SV=1
9	AFDB:P26674	0.225	0.308	1.350E-13	911	0.065	0.091	P26674.pdb.gz	STE6_SCHPO Protein ste6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ste6 PE=4 SV=1
10	AFDB:Q9NZN5	0.212	0.178	1.595E-13	1544	0.097	0.080	Q9NZN5.pdb.gz	ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1
11	PDB:4mt6A	0.199	0.547	2.944E-12	389	0.046	0.149	4mt6A.pdb.gz
12	PDB:4f7zA	0.228	0.301	4.862E-12	946	0.057	0.077	4f7zA.pdb.gz
13	PDB:2byvE	0.222	0.301	5.286E-12	922	0.059	0.081	2byvE.pdb.gz
14	PDB:7rx9A	0.144	0.409	7.701E-12	432	0.060	0.176	7rx9A.pdb.gz
15	PDB:4gouA	0.137	0.302	1.987E-6	507	0.035	0.087	4gouA.pdb.gz
16	PDB:3ljuX	0.073	0.237	3.131E-4	373	0.016	0.056	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:6bbpA	0.077	0.180	4.375E-4	520	0.027	0.067	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:6u3eA	0.072	0.219	1.813E-3	397	0.024	0.078	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:6hhgA	0.067	0.214	9.656E-3	386	0.014	0.047	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
20	PDB:4uudC	0.067	0.600	1.141E-2	113	0.016	0.177	4uudC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2X0SFL3	0.0	1676	1237	0.660	0.679	A0A2X0SFL3_HUMAN RASGRF2 (Fragment) OS=Homo sapiens OX=9606 GN=RASGRF2 PE=4 SV=1
2	O14827	0.0	1676	1237	0.660	0.679	RGRF2_HUMAN Ras-specific guanine nucleotide-releasing factor 2 OS=Homo sapiens OX=9606 GN=RASGRF2 PE=1 SV=2
3	P27671	0.0	2180	1262	0.837	0.845	RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus OX=10090 GN=Rasgrf1 PE=1 SV=2
4	P28818	0.0	2158	1244	0.832	0.851	RGRF1_RAT Ras-specific guanine nucleotide-releasing factor 1 OS=Rattus norvegicus OX=10116 GN=Rasgrf1 PE=1 SV=1
5	P70392	0.0	1639	1189	0.655	0.701	RGRF2_MOUSE Ras-specific guanine nucleotide-releasing factor 2 OS=Mus musculus OX=10090 GN=Rasgrf2 PE=1 SV=2
6	Q13972	0.0	2649	1273	1.000	1.000	RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens OX=9606 GN=RASGRF1 PE=1 SV=2
7	Q99JE4	0.0	1645	1190	0.658	0.703	RGRF2_RAT Ras-specific guanine nucleotide-releasing factor 2 OS=Rattus norvegicus OX=10116 GN=Rasgrf2 PE=1 SV=1
8	Q8IS18	6.26e-48	189	1037	0.101	0.123	GEFE_DICDI Ras guanine nucleotide exchange factor E OS=Dictyostelium discoideum OX=44689 GN=gefE PE=2 SV=1
9	P26675	4.32e-42	171	1596	0.082	0.066	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
10	Q54PQ4	1.31e-40	162	605	0.082	0.172	GEFA_DICDI Ras guanine nucleotide exchange factor A OS=Dictyostelium discoideum OX=44689 GN=gefA PE=1 SV=1
11	B0M0P8	2.26e-38	159	2356	0.067	0.036	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
12	Q86G47	6.28e-38	157	1298	0.063	0.062	GEFQ_DICDI Ras guanine nucleotide exchange factor Q OS=Dictyostelium discoideum OX=44689 GN=gefQ PE=2 SV=1
13	F1R019	4.56e-37	155	1341	0.082	0.078	F1R019_DANRE Son of sevenless homolog 2 OS=Danio rerio OX=7955 GN=si:ch211-67f24.8 PE=1 SV=2
14	G1TRT1	1.24e-36	153	1304	0.077	0.075	G1TRT1_RABIT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Oryctolagus cuniculus OX=9986 GN=SOS1 PE=4 SV=2
15	Q62245	2.29e-36	152	1319	0.077	0.074	SOS1_MOUSE Son of sevenless homolog 1 OS=Mus musculus OX=10090 GN=Sos1 PE=1 SV=2
16	A0A8I6B4D6	2.73e-36	152	1283	0.077	0.076	A0A8I6B4D6_RAT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Sos1 PE=1 SV=1
17	D4A3T0	3.22e-36	152	1319	0.077	0.074	D4A3T0_RAT SOS Ras/Rac guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Sos1 PE=1 SV=2
18	Q07889	3.76e-36	152	1333	0.077	0.074	SOS1_HUMAN Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1
19	Q02384	6.28e-36	151	1333	0.082	0.078	SOS2_MOUSE Son of sevenless homolog 2 OS=Mus musculus OX=10090 GN=Sos2 PE=1 SV=2
20	Q8C5V7	1.20e-35	147	642	0.072	0.143	Q8C5V7_MOUSE Rap guanine nucleotide exchange factor 1 (Fragment) OS=Mus musculus OX=10090 GN=Rapgef1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15070 GOLGA2L5	5.3	17.4	Putative golgin subfamily A member 2-like protein 5
2	PF00612 IQ	39	15.4	IQ calmodulin-binding motif
3	PF00169 PH	4.4e-22	89.9	PH domain
4	PF15413 PH_11	15	17.5	Pleckstrin homology domain
5	PF16652 PH_13	46	15.4	Pleckstrin homology domain
6	PF18012 PH_17	8.4e+02	11.2	PH domain
7	PF20399 PH_20	85	14.7	PH domain
8	PF15410 PH_9	3.2e+02	12.9	Pleckstrin homology domain
9	PF00617 RasGEF	8e-54	194.1	RasGEF domain
10	PF00618 RasGEF_N	1.6e-19	81.4	RasGEF N-terminal motif
11	PF00621 RhoGEF	1.7e-29	114.9	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405963

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000477455	0.995	Glutamate receptor ionotropic, NMDA 2B
2	9606.ENSP00000407586	0.981	GTPase HRas
3	9606.ENSP00000256078	0.968	GTPase KRas
4	9606.ENSP00000431418	0.965	High affinity nerve growth factor receptor
5	9606.ENSP00000383118	0.949	Cell division control protein 42 homolog
6	9606.ENSP00000246792	0.948	Ras-related protein R-Ras
7	9606.ENSP00000348461	0.933	Ras-related C3 botulinum toxin substrate 1
8	9606.ENSP00000358548	0.931	GTPase NRas
9	9606.ENSP00000378699	0.918	Cyclin-dependent kinase 1
10	9606.ENSP00000358525	0.914	Beta-nerve growth factor
11	9606.ENSP00000256442	0.913	G2/mitotic-specific cyclin-B1
12	9606.ENSP00000248975	0.911	14-3-3 protein eta
13	9606.ENSP00000361275	0.909	Serine/threonine-protein kinase PLK3
14	9606.ENSP00000255882	0.905	Phosphatidylinositol 4-kinase alpha
15	9606.ENSP00000372023	0.904	Serine/threonine-protein kinase Chk2
16	9606.ENSP00000388648	0.902	Serine/threonine-protein kinase Chk1
17	9606.ENSP00000400175	0.902	Transforming protein RhoA
18	9606.ENSP00000309591	0.868	cAMP-dependent protein kinase catalytic subunit alpha
19	9606.ENSP00000289104	0.860	Ras-related protein M-Ras
20	9606.ENSP00000366488	0.848	cAMP-dependent protein kinase catalytic subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005515	0.999	protein binding
GO:0019899	0.716	enzyme binding
GO:0051020	0.370	GTPase binding
GO:0031267	0.354	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.989	response to stimulus
GO:0009987	0.988	cellular process
GO:0009966	0.985	regulation of signal transduction
GO:1902531	0.982	regulation of intracellular signal transduction
GO:0051716	0.975	cellular response to stimulus
GO:0048518	0.886	positive regulation of biological process
GO:0051056	0.877	regulation of small GTPase mediated signal transduction
GO:0048522	0.876	positive regulation of cellular process
GO:0007154	0.842	cell communication
GO:0023052	0.841	signaling
GO:0007165	0.805	signal transduction
GO:0046579	0.774	positive regulation of Ras protein signal transduction
GO:0006950	0.637	response to stress
GO:0034976	0.582	response to endoplasmic reticulum stress
GO:0065009	0.524	regulation of molecular function
GO:0065008	0.379	regulation of biological quality
GO:0032501	0.372	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043226	0.967	organelle
GO:0005829	0.963	cytosol
GO:0043227	0.956	membrane-bounded organelle
GO:0043229	0.915	intracellular organelle
GO:0043231	0.913	intracellular membrane-bounded organelle
GO:0012505	0.624	endomembrane system
GO:0043005	0.574	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]