StarFunc result for job id Q13976

User Input

>input (671 residues)
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPP
PDDNSGWDIDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P00516	0.914	0.914	0.000	671	0.997	0.997	P00516.pdb.gz	KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus OX=9913 GN=PRKG1 PE=1 SV=2
2	AFDB:Q03043	0.883	0.549	7.076E-94	1088	0.636	0.392	Q03043.pdb.gz	KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster OX=7227 GN=for PE=1 SV=3
3	AFDB:O76360	0.875	0.755	8.656E-86	780	0.511	0.440	O76360.pdb.gz	EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans OX=6239 GN=egl-4 PE=1 SV=2
4	AFDB:Q03042	0.863	0.756	1.980E-84	768	0.510	0.445	Q03042.pdb.gz	KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster OX=7227 GN=Pkg21D PE=1 SV=2
5	AFDB:Q13237	0.841	0.744	3.436E-81	762	0.519	0.457	Q13237.pdb.gz	KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens OX=9606 GN=PRKG2 PE=1 SV=1
6	AFDB:Q8I719	0.439	0.348	2.266E-53	853	0.288	0.226	Q8I719.pdb.gz	KGP_PLAF7 cGMP-dependent protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PKG PE=1 SV=1
7	AFDB:Q8MMZ7	0.431	0.293	4.669E-52	994	0.277	0.187	Q8MMZ7.pdb.gz	KGP_TOXGO cGMP-dependent protein kinase OS=Toxoplasma gondii OX=5811 GN=PKG PE=1 SV=1
8	AFDB:Q8MMZ8	0.753	0.512	1.895E-50	1003	0.291	0.194	Q8MMZ8.pdb.gz	KGP_EIMTE cGMP-dependent protein kinase OS=Eimeria tenella OX=5802 GN=PKG PE=1 SV=1
9	PDB:5dykA	0.410	0.342	2.352E-50	809	0.270	0.224	5dykA.pdb.gz
10	AFDB:Q7JP68	0.464	0.774	1.168E-34	398	0.204	0.344	Q7JP68.pdb.gz	KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans OX=6239 GN=F47F2.1 PE=1 SV=1
11	AFDB:P16912	0.462	0.531	3.494E-34	583	0.215	0.247	P16912.pdb.gz	KAPC3_DROME cAMP-dependent protein kinase catalytic subunit 3 OS=Drosophila melanogaster OX=7227 GN=Pka-C3 PE=2 SV=2
12	PDB:6byrA	0.454	0.743	4.304E-33	405	0.212	0.351	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
13	PDB:5x3fB	0.407	0.772	9.138E-29	349	0.195	0.375	5x3fB.pdb.gz
14	PDB:3pfqA	0.408	0.521	1.045E-25	523	0.183	0.235	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
15	PDB:3c4wB	0.406	0.521	6.487E-25	519	0.139	0.179	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
16	PDB:6byrB	0.355	0.765	2.044E-24	288	0.136	0.316	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
17	PDB:4dinB	0.354	0.642	2.518E-24	345	0.140	0.272	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
18	PDB:3nynA	0.443	0.533	2.795E-24	554	0.136	0.164	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.
19	PDB:6pjxA	0.424	0.519	2.795E-24	543	0.140	0.173	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
20	PDB:4yhjA	0.413	0.548	4.026E-24	501	0.134	0.180	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A9E8	0.0	1211	686	0.911	0.891	A0A8I6A9E8_RAT cGMP-dependent protein kinase OS=Rattus norvegicus OX=10116 GN=Prkg1 PE=3 SV=1
2	A0A8I6ATM1	0.0	1384	671	0.996	0.996	A0A8I6ATM1_RAT cGMP-dependent protein kinase OS=Rattus norvegicus OX=10116 GN=Prkg1 PE=3 SV=1
3	A0A8I6B3H1	0.0	726	382	0.525	0.921	A0A8I6B3H1_RAT cGMP-dependent protein kinase OS=Rattus norvegicus OX=10116 GN=Prkg1 PE=3 SV=1
4	O76360	0.0	692	780	0.510	0.438	EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans OX=6239 GN=egl-4 PE=1 SV=2
5	P00516	0.0	1385	671	0.997	0.997	KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus OX=9913 GN=PRKG1 PE=1 SV=2
6	P0C605	0.0	1385	671	0.996	0.996	KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus OX=10090 GN=Prkg1 PE=1 SV=1
7	P32023	0.0	729	934	0.528	0.379	KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster OX=7227 GN=for PE=2 SV=3
8	Q03042	0.0	712	768	0.520	0.454	KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster OX=7227 GN=Pkg21D PE=1 SV=2
9	Q03043	0.0	851	1088	0.635	0.392	KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster OX=7227 GN=for PE=1 SV=3
10	Q13237	0.0	681	762	0.537	0.472	KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens OX=9606 GN=PRKG2 PE=1 SV=1
11	Q13976	0.0	1390	671	1.000	1.000	KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PRKG1 PE=1 SV=3
12	Q61410	0.0	677	762	0.531	0.467	KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus OX=10090 GN=Prkg2 PE=1 SV=1
13	Q64595	0.0	681	762	0.541	0.476	KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Prkg2 PE=1 SV=1
14	Q58G65	4.35e-95	299	343	0.221	0.431	Q58G65_TOXGO cAMP-dependent protein kinase catalytic subunit isoform 2 OS=Toxoplasma gondii OX=5811 GN=PKA2 PE=2 SV=1
15	P51817	7.26e-95	299	358	0.206	0.385	PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens OX=9606 GN=PRKX PE=1 SV=1
16	Q8I719	1.77e-94	312	853	0.291	0.229	KGP_PLAF7 cGMP-dependent protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PKG PE=1 SV=1
17	W7JX98	1.77e-94	312	853	0.291	0.229	KGP_PLAFO cGMP-dependent protein kinase OS=Plasmodium falciparum (isolate NF54) OX=5843 GN=PKG PE=1 SV=2
18	Q38DR5	6.42e-92	290	334	0.215	0.431	Q38DR5_TRYB2 Protein kinase A catalytic subunit isoform 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2410 PE=3 SV=1
19	Q38DS1	9.84e-92	290	336	0.218	0.435	Q38DS1_TRYB2 Protein kinase A catalytic subunit isoform 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2360 PE=3 SV=1
20	P22694	2.62e-91	289	351	0.209	0.399	KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens OX=9606 GN=PRKACB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	73	14.6	Phosphotransferase enzyme family
2	PF00027 cNMP_binding	6.5e-36	133.6	Cyclic nucleotide-binding domain
3	PF14544 DUF4443	7.2e+02	11.6	Domain of unknown function (DUF4443)
4	PF14531 Kinase-like	0.012	26.6	Kinase-like
5	PF11594 Med28	2e+02	13.8	Mediator complex subunit 28
6	PF10018 Med4	3.1e+02	12.4	Vitamin-D-receptor interacting Mediator subunit 4
7	PF16808 PKcGMP_CC	1.3e-10	52.1	Coiled-coil N-terminus of cGMP-dependent protein kinase
8	PF00069 Pkinase	1.1e-67	239.8	Protein kinase domain
9	PF00433 Pkinase_C	1.6e+02	14.4	Protein kinase C terminal domain
10	PF07714 PK_Tyr_Ser-Thr	2.2e-32	124.0	Protein tyrosine and serine/threonine kinase
11	PF17098 Wtap	20	16.6	WTAP/Mum2p family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9031.ENSGALP00000006027

Rank	PPI partner	STRING score	Description
1	9031.ENSGALP00000009023	0.998	Murine retrovirus integration site 1 homolog
2	9031.ENSGALP00000016789	0.985	Regulates myosin phosphatase activity.
3	9031.ENSGALP00000000449	0.873	Protein phosphatase 1, regulatory subunit 12B
4	9031.ENSGALP00000031272	0.850	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
5	9031.ENSGALP00000007265	0.843	Gallus gallus protein phosphatase 1, catalytic subunit, gamma isozyme (PPP1CC), mRNA
6	9031.ENSGALP00000039705	0.839	Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and in [...]
7	9031.ENSGALP00000027685	0.810	Guanylate cyclase 1, soluble, alpha 2
8	9031.ENSGALP00000017721	0.808	Protein kinase, cGMP-dependent, type II
9	9031.ENSGALP00000041017	0.806	Gallus gallus potassium large conductance calcium-activated channel, subfamily M, beta member 1 (KCNMB1), mRNA
10	9031.ENSGALP00000016303	0.801	Gallus gallus potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4), mRNA
11	9031.ENSGALP00000041168	0.800	Uncharacterized protein
12	9031.ENSGALP00000041645	0.800	Uncharacterized protein
13	9031.ENSGALP00000019524	0.798	Phosphodiesterase 5A, cGMP-specific
14	9031.ENSGALP00000020523	0.777	G kinase anchoring protein 1
15	9031.ENSGALP00000015230	0.761	Guanylate cyclase 1, soluble, beta 3
16	9031.ENSGALP00000008123	0.757	Uncharacterized protein
17	9031.ENSGALP00000015217	0.757	Guanylate cyclase 1, soluble, alpha 3
18	9031.ENSGALP00000019412	0.740	Septin 3
19	9031.ENSGALP00000001168	0.701	Guanylate cyclase
20	9031.ENSGALP00000025359	0.699	Guanylate cyclase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0042802	0.998	identical protein binding
GO:0004690	0.991	cyclic nucleotide-dependent protein kinase activity
GO:0019899	0.758	enzyme binding
GO:0019901	0.672	protein kinase binding
GO:0051019	0.644	mitogen-activated protein kinase binding
GO:0004692	0.366	cGMP-dependent protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0048589	0.988	developmental growth
GO:0003012	0.987	muscle system process
GO:0019216	0.986	regulation of lipid metabolic process
GO:0010565	0.986	regulation of cellular ketone metabolic process
GO:0007507	0.986	heart development
GO:0051952	0.985	regulation of amine transport
GO:0014910	0.985	regulation of smooth muscle cell migration
GO:0045822	0.985	negative regulation of heart contraction
GO:0097746	0.985	blood vessel diameter maintenance
GO:0014048	0.984	regulation of glutamate secretion
GO:0019218	0.983	regulation of steroid metabolic process
GO:0051953	0.983	negative regulation of amine transport
GO:0010566	0.983	regulation of ketone biosynthetic process
GO:1901018	0.983	positive regulation of potassium ion transmembrane transporter activity
GO:0003300	0.981	cardiac muscle hypertrophy
GO:0055017	0.981	cardiac muscle tissue growth
GO:0006109	0.980	regulation of carbohydrate metabolic process
GO:2001259	0.980	positive regulation of cation channel activity
GO:1902930	0.979	regulation of alcohol biosynthetic process
GO:0009892	0.974	negative regulation of metabolic process
GO:0071840	0.969	cellular component organization or biogenesis
GO:0048523	0.967	negative regulation of cellular process
GO:0046890	0.964	regulation of lipid biosynthetic process
GO:0042311	0.961	vasodilation
GO:0062014	0.958	negative regulation of small molecule metabolic process
GO:0010675	0.952	regulation of cellular carbohydrate metabolic process
GO:0016043	0.941	cellular component organization
GO:2000146	0.931	negative regulation of cell motility
GO:0042753	0.929	positive regulation of circadian rhythm
GO:0030336	0.903	negative regulation of cell migration
GO:0060322	0.863	head development
GO:0031324	0.840	negative regulation of cellular metabolic process
GO:0048468	0.832	cell development
GO:0007276	0.828	gamete generation
GO:0007420	0.819	brain development
GO:0051174	0.813	regulation of phosphorus metabolic process
GO:0050896	0.755	response to stimulus
GO:0008152	0.704	metabolic process
GO:0003006	0.689	developmental process involved in reproduction
GO:0048588	0.667	developmental cell growth
GO:0071704	0.661	organic substance metabolic process
GO:0010563	0.647	negative regulation of phosphorus metabolic process
GO:0044237	0.646	cellular metabolic process
GO:0045936	0.640	negative regulation of phosphate metabolic process
GO:0044238	0.625	primary metabolic process
GO:0006468	0.570	protein phosphorylation
GO:0051716	0.478	cellular response to stimulus
GO:0035556	0.415	intracellular signal transduction
GO:0009653	0.391	anatomical structure morphogenesis
GO:0032101	0.383	regulation of response to external stimulus
GO:0048585	0.383	negative regulation of response to stimulus
GO:0050790	0.344	regulation of catalytic activity
GO:0034330	0.334	cell junction organization
GO:0006996	0.313	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0005886	0.997	plasma membrane
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0005829	0.968	cytosol
GO:0097708	0.951	intracellular vesicle
GO:0031410	0.935	cytoplasmic vesicle
GO:0099503	0.913	secretory vesicle
GO:0005634	0.846	nucleus
GO:0031974	0.394	membrane-enclosed lumen
GO:0070013	0.373	intracellular organelle lumen
GO:0005794	0.307	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.12	0.366	cGMP-dependent protein kinase.

[back to server]