StarFunc result for job id Q14004

User Input

>input (1512 residues)
MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLF
LAAPGTAAAAAAAAAASSSCFSPGPPLEVKRLARGKRRAGGRQKRRRGPRAGQEAEKRRV
FSLPQPQQDGGGGASSGGGVTPLVEYEDVSSQSEQGLLLGGASAATAATAAGGTGGSGGS
PASSSGTQRRGEGSERRPRRDRRSSSGRSKERHREHRRRDGQRGGSEASKSRSRHSHSGE
ERAEVAKSGSSSSSGGRRKSASATSSSSSSRKDRDSKAHRSRTKSSKEPPSAYKEPPKAY
REDKTEPKAYRRRRSLSPLGGRDDSPVSHRASQSLRSRKSPSPAGGGSSPYSRRLPRSPS
PYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYSPVLRRSGKSRSRSPYSSRHS
RSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEATKAA
EAAAKAAKASNTSTPTKGNTETSASASQTNHVKDVKKIKIEHAPSPSSGGTLKNDKAKTK
PPLQVTKVENNLIVDKATKKAVIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHV
ALVTSTLPPLPLPPMLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDD
LSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDKFDIIGIIGEGTYGQVY
KARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDF
KKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKC
SNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSC
GCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKL
REEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHEL
WSKKRRRQKQMGMTDDVSTIKAPRKDLSLGLDDSRTNTPQGVLPSSQLKSQGSSNVAPVK
TGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNSETQQQLNKINLPAGILATGE
KQTDPSTPQQESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKD
VLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQR
PPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGG
IDYQAGDTYVSTSDYKDNFGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSLDNY
STASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAGPMLFSGDKDHRFEYSHGPIAVLANS
SDPSTGPESTHPLPAKMHNYNYGGNLQENPSGPSLMHGQTWTSPAQGPGYSQGYRGHIST
STGRGRGRGLPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14004	0.999	0.999	0.000	1512	1.000	1.000	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
2	AFDB:Q9NYV4	0.281	0.285	1.537E-92	1490	0.440	0.447	Q9NYV4.pdb.gz	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
3	PDB:3mi9A	0.197	0.853	2.034E-31	329	0.101	0.462	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
4	PDB:1unlA	0.186	0.926	2.110E-29	292	0.080	0.414	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
5	PDB:4krcA	0.187	0.920	1.821E-28	297	0.077	0.394	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
6	PDB:4eomC	0.175	0.914	3.599E-27	276	0.081	0.442	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
7	PDB:4yc3A	0.180	0.872	6.984E-27	295	0.081	0.414	4yc3A.pdb.gz
8	PDB:4gcjA	0.181	0.851	1.028E-26	304	0.086	0.428	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
9	PDB:4ek6A	0.172	0.876	2.535E-25	279	0.078	0.423	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
10	PDB:7opmA	0.188	0.751	5.596E-24	362	0.077	0.320	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
11	PDB:7kpvA	0.183	0.741	3.871E-23	357	0.067	0.286	7kpvA.pdb.gz
12	PDB:2b9iA	0.176	0.739	4.829E-23	338	0.073	0.325	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.
13	AFDB:F6NWN5	0.171	0.208	5.221E-22	1229	0.126	0.155	F6NWN5.pdb.gz	F6NWN5_DANRE Homeodomain-interacting protein kinase 3a OS=Danio rerio OX=7955 GN=si:dkey-21k24.2 PE=4 SV=1
14	AFDB:Q09690	0.175	0.240	4.263E-21	1087	0.140	0.195	Q09690.pdb.gz	POM1_SCHPO DYRK-family kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pom1 PE=1 SV=1
15	AFDB:Q9VUQ9	0.172	0.126	9.764E-21	2139	0.202	0.143	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
16	AFDB:B3DI12	0.181	0.259	1.360E-20	1039	0.121	0.176	B3DI12.pdb.gz	B3DI12_DANRE Cyclin-dependent kinase-like 5 isoform 2 OS=Danio rerio OX=7955 GN=zgc:194395 PE=2 SV=1
17	AFDB:O76039	0.180	0.280	2.117E-20	960	0.127	0.200	O76039.pdb.gz	CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens OX=9606 GN=CDKL5 PE=1 SV=2
18	AFDB:F4HQ88	0.181	0.230	6.391E-20	1169	0.127	0.164	F4HQ88.pdb.gz	F4HQ88_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DYRKP-2A PE=1 SV=1
19	AFDB:A0A669KBC2	0.182	0.270	1.240E-19	1001	0.128	0.194	A0A669KBC2.pdb.gz	A0A669KBC2_HUMAN Cyclin dependent kinase like 5 OS=Homo sapiens OX=9606 GN=CDKL5 PE=1 SV=1
20	AFDB:O08815	0.163	0.203	1.411E-18	1206	0.093	0.116	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y4Z0	0.0	2632	1308	0.854	0.987	A0A2R8Y4Z0_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
2	A0A2R8Y7W5	0.0	1449	1099	0.468	0.643	A0A2R8Y7W5_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
3	A0A2R8YD28	0.0	921	456	0.293	0.971	A0A2R8YD28_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
4	A0A2R8YF61	0.0	1334	915	0.498	0.823	A0A2R8YF61_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
5	J3QSD7	0.0	804	1201	0.262	0.330	J3QSD7_HUMAN Cyclin dependent kinase 12 (Fragment) OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=1
6	Q14004	0.0	3072	1512	1.000	1.000	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
7	Q14AX6	0.0	820	1484	0.269	0.274	CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus OX=10090 GN=Cdk12 PE=1 SV=2
8	Q3MJK5	0.0	814	1484	0.266	0.271	CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus OX=10116 GN=Cdk12 PE=1 SV=1
9	Q69ZA1	0.0	2279	1511	0.954	0.954	CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus OX=10090 GN=Cdk13 PE=1 SV=3
10	Q9NYV4	0.0	817	1490	0.268	0.272	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
11	Q9VP22	1.01e-178	567	1157	0.176	0.230	CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster OX=7227 GN=Cdk12 PE=1 SV=1
12	P46551	7.21e-133	431	730	0.138	0.286	CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans OX=6239 GN=cdk-12 PE=1 SV=4
13	Q9LFT8	2.72e-112	367	505	0.116	0.349	CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana OX=3702 GN=CDKC-1 PE=1 SV=1
14	Q8W4P1	5.62e-111	363	513	0.116	0.341	CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana OX=3702 GN=CDKC-2 PE=1 SV=2
15	O14098	3.27e-93	316	593	0.101	0.258	CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsk1 PE=1 SV=1
16	Q641Z4	1.09e-89	298	372	0.099	0.401	CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus OX=10116 GN=Cdk9 PE=2 SV=1
17	Q99J95	1.09e-89	298	372	0.099	0.401	CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus OX=10090 GN=Cdk9 PE=1 SV=1
18	P50750	5.89e-89	296	372	0.098	0.398	CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3
19	Q7SXE8	2.42e-86	289	374	0.099	0.398	CDK9_DANRE Cyclin-dependent kinase 9 OS=Danio rerio OX=7955 GN=cdk9 PE=2 SV=1
20	Q9CAG1	3.81e-85	298	752	0.097	0.194	Q9CAG1_ARATH cyclin-dependent kinase OS=Arabidopsis thaliana OX=3702 GN=CDKG2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.0081	26.9	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	0.0047	27.6	Haspin like kinase domain
3	PF06293 Kdo	99	13.8	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	9.3	17.1	Kinase-like
5	PF00069 Pkinase	6e-70	247.2	Protein kinase domain
6	PF17667 Pkinase_fungal	3.1e+02	11.5	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	2.8e-31	120.3	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000181839

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374529	0.999	Cyclin-K
2	9606.ENSP00000261900	0.934	Cyclin-T1
3	9606.ENSP00000470252	0.915	Transcription elongation factor SPT5
4	9606.ENSP00000480158	0.915	DNA-directed RNA polymerase II subunit RPB1
5	9606.ENSP00000256897	0.914	Cyclin-H
6	9606.ENSP00000264157	0.913	Cyclin-T2
7	9606.ENSP00000348308	0.910	Matrix metalloproteinase-23
8	9606.ENSP00000357798	0.900	Matrix metalloproteinase-21
9	9606.ENSP00000398880	0.900	Cyclin-dependent kinase 12
10	9606.ENSP00000257904	0.873	Cyclin-dependent kinase 4
11	9606.ENSP00000266970	0.860	Cyclin-dependent kinase 2
12	9606.ENSP00000296328	0.824	UBX domain-containing protein 7
13	9606.ENSP00000256443	0.819	Cyclin-dependent kinase 7
14	9606.ENSP00000262643	0.818	G1/S-specific cyclin-E1
15	9606.ENSP00000225698	0.800	Complement component 1 Q subcomponent-binding protein, mitochondrial
16	9606.ENSP00000363836	0.800	Cyclin-Y
17	9606.ENSP00000256442	0.796	G2/mitotic-specific cyclin-B1
18	9606.ENSP00000378699	0.794	Cyclin-dependent kinase 1
19	9606.ENSP00000274026	0.792	Cyclin-A2
20	9606.ENSP00000369390	0.787	Cyclin-dependent kinase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030332	1.000	cyclin binding
GO:0008353	1.000	RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0003723	0.998	RNA binding
GO:0019899	0.740	enzyme binding
GO:0019900	0.684	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0050789	0.986	regulation of biological process
GO:0006396	0.985	RNA processing
GO:0050794	0.984	regulation of cellular process
GO:0008380	0.984	RNA splicing
GO:0006397	0.952	mRNA processing
GO:0000398	0.942	mRNA splicing, via spliceosome
GO:0000380	0.921	alternative mRNA splicing, via spliceosome
GO:0019222	0.826	regulation of metabolic process
GO:0060255	0.782	regulation of macromolecule metabolic process
GO:0031323	0.750	regulation of cellular metabolic process
GO:0080090	0.746	regulation of primary metabolic process
GO:0051171	0.745	regulation of nitrogen compound metabolic process
GO:1901564	0.675	organonitrogen compound metabolic process
GO:0048518	0.666	positive regulation of biological process
GO:0019219	0.629	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.610	regulation of gene expression
GO:0048522	0.593	positive regulation of cellular process
GO:0051252	0.576	regulation of RNA metabolic process
GO:0019538	0.555	protein metabolic process
GO:0043412	0.549	macromolecule modification
GO:0036211	0.523	protein modification process
GO:0009893	0.433	positive regulation of metabolic process
GO:0010556	0.427	regulation of macromolecule biosynthetic process
GO:0031326	0.427	regulation of cellular biosynthetic process
GO:0006355	0.376	regulation of DNA-templated transcription
GO:0010604	0.333	positive regulation of macromolecule metabolic process
GO:0031325	0.320	positive regulation of cellular metabolic process
GO:0051173	0.317	positive regulation of nitrogen compound metabolic process
GO:0048519	0.305	negative regulation of biological process
GO:0048523	0.300	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0032991	0.995	protein-containing complex
GO:0016604	0.995	nuclear body
GO:0005829	0.994	cytosol
GO:0061695	0.966	transferase complex, transferring phosphorus-containing groups
GO:0016607	0.948	nuclear speck
GO:0012505	0.947	endomembrane system
GO:1902911	0.926	protein kinase complex
GO:1902554	0.924	serine/threonine protein kinase complex
GO:0005794	0.918	Golgi apparatus
GO:0000307	0.905	cyclin-dependent protein kinase holoenzyme complex
GO:0140513	0.708	nuclear protein-containing complex
GO:0002945	0.388	cyclin K-CDK13 complex
GO:0005576	0.356	extracellular region
GO:0005615	0.339	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10216	1.000	[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase]
EC:2.7.11.23	1.000	[RNA-polymerase]-subunit kinase.

[back to server]