StarFunc result for job id Q14005

User Input

>input (1332 residues)
MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSS
VQLADTSEAGPSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEA
QSSNFLFPKACHQRARSNSTSVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQL
DCPAGKAAGTSRPTRSLSTAQLVQPSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYG
PIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTHQDALQKFKQAKKGLLTLTVR
TRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNYRIMVEVSLQK
EAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNE
VYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLES
SWHGRPTLEKEREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPGSGSAEKPSSDVDIS
THSPSLPLAREPVVLSIASSRLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPP
PRKYFKSDSDPQKSLEERENSSCSSGHTPPTCGQEARELLPLLLPQEDTAGRSPSASAGC
PGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQARMDYSFDTTAEDPWVRISDC
IKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLDTANGTPKVYKSADSSTVK
KGPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIR
QRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQP
EQVLSSGSPAASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMP
SQRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKE
GASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDGDHSSLQSGQS
VISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVIT
VHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTP
EAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKP
LTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKS
LQSKETTAAGDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54824	0.311	0.313	0.000	1322	0.810	0.816	O54824.pdb.gz	IL16_MOUSE Pro-interleukin-16 OS=Mus musculus OX=10090 GN=Il16 PE=1 SV=3
2	AFDB:Q14005	1.000	1.000	0.000	1332	1.000	1.000	Q14005.pdb.gz	IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens OX=9606 GN=IL16 PE=1 SV=4
3	AFDB:A0A087WZG6	0.077	0.098	3.509E-16	1030	0.132	0.171	A0A087WZG6.pdb.gz	A0A087WZG6_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
4	AFDB:Q5TCQ9	0.071	0.065	1.112E-15	1481	0.119	0.107	Q5TCQ9.pdb.gz	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
5	AFDB:Q9EQJ9	0.066	0.061	2.533E-15	1476	0.127	0.114	Q9EQJ9.pdb.gz	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
6	AFDB:Q9VUE8	0.142	0.075	2.827E-15	2637	0.199	0.100	Q9VUE8.pdb.gz	Q9VUE8_DROME Big bang, isoform C OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=2
7	AFDB:Q9VKG8	0.092	0.070	3.521E-15	1916	0.145	0.101	Q9VKG8.pdb.gz	Q9VKG8_DROME Discs large 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Dlg5 PE=1 SV=1
8	PDB:2xkxA	0.072	0.128	4.917E-11	721	0.044	0.080	2xkxA.pdb.gz
9	AFDB:A0A2R8QMK9	0.070	0.056	2.200E-8	1689	0.143	0.113	A0A2R8QMK9.pdb.gz
10	PDB:7p73A	0.067	0.208	3.382E-8	420	0.035	0.110	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
11	PDB:7pc3A	0.066	0.210	5.562E-7	405	0.029	0.094	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
12	AFDB:Q9W2S5	0.079	0.055	7.387E-7	2139	0.152	0.094	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
13	AFDB:A1ZAN6	0.058	0.032	1.351E-6	2559	0.110	0.057	A1ZAN6.pdb.gz	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
14	PDB:7p70A	0.065	0.205	2.588E-6	407	0.024	0.079	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:7pc5A	0.062	0.200	5.896E-6	405	0.023	0.077	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7qqmA	0.064	0.201	1.079E-5	413	0.023	0.075	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:6t36A	0.064	0.829	1.499E-5	93	0.017	0.247	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
18	PDB:5n7dA	0.062	0.190	3.417E-5	423	0.016	0.050	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
19	PDB:6pcvA	0.054	0.094	4.028E-5	754	0.027	0.048	6pcvA.pdb.gz
20	PDB:7qqnC	0.059	0.185	7.369E-5	414	0.017	0.053	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YLH9	0.0	1140	611	0.429	0.935	H0YLH9_HUMAN Pro-interleukin-16 (Fragment) OS=Homo sapiens OX=9606 GN=IL16 PE=1 SV=2
2	O54824	0.0	1944	1322	0.808	0.814	IL16_MOUSE Pro-interleukin-16 OS=Mus musculus OX=10090 GN=Il16 PE=1 SV=3
3	Q14005	0.0	2691	1332	1.000	1.000	IL16_HUMAN Pro-interleukin-16 OS=Homo sapiens OX=9606 GN=IL16 PE=1 SV=4
4	O15018	4.18e-59	227	2839	0.094	0.044	PDZD2_HUMAN PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PDZD2 PE=1 SV=4
5	Q9QZR8	7.45e-59	226	2766	0.100	0.048	PDZD2_RAT PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Pdzd2 PE=1 SV=1
6	O75970	4.19e-18	93.6	2070	0.053	0.034	MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2
7	Q9W283	1.16e-17	91.7	1329	0.032	0.032	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
8	A0A0B4LG21	1.65e-17	91.3	1087	0.032	0.040	A0A0B4LG21_DROME Arc, isoform D OS=Drosophila melanogaster OX=7227 GN=a PE=4 SV=1
9	G5ECZ8	2.08e-17	91.3	2422	0.048	0.026	G5ECZ8_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mpz-1 PE=1 SV=2
10	A0A2R8Y549	3.52e-17	90.5	1882	0.033	0.023	A0A2R8Y549_HUMAN PATJ crumbs cell polarity complex component OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=1
11	Q15K27	1.33e-16	82.0	207	0.028	0.179	Q15K27_DROME BBG-LP15 (Fragment) OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=1
12	Q15K34	1.44e-16	82.4	222	0.028	0.167	Q15K34_DROME BBG-LP12 (Fragment) OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=1
13	Q15K32	1.46e-16	82.4	224	0.028	0.165	Q15K32_DROME BBG-LP29 (Fragment) OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=1
14	Q15K25	1.79e-16	82.4	235	0.028	0.157	Q15K25_DROME BBG-LP15 (Fragment) OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=1
15	Q15K30	1.82e-16	82.8	240	0.028	0.154	Q15K30_DROME BBG-LP43 (Fragment) OS=Drosophila melanogaster OX=7227 GN=bbg PE=2 SV=1
16	A0A087WZG6	7.23e-16	85.9	1030	0.047	0.060	A0A087WZG6_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
17	O55164	7.52e-16	86.3	2054	0.032	0.020	MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1
18	Q8VBX6	7.91e-16	85.9	2055	0.032	0.020	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
19	A0A087WYL6	8.49e-16	85.5	1062	0.047	0.058	A0A087WYL6_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
20	Q8TEW8	9.73e-16	85.5	1205	0.047	0.051	PAR3L_HUMAN Partitioning defective 3 homolog B OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	8.7e-46	165.5	PDZ domain
2	PF13180 PDZ_2	6.3e-07	41.0	PDZ domain
3	PF17820 PDZ_6	1.7e-20	84.0	PDZ domain
4	PF02163 Peptidase_M50	0.00083	30.3	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302935

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000011653	0.998	T-cell surface glycoprotein CD4
2	9606.ENSP00000311032	0.945	Caspase-3
3	9606.ENSP00000371958	0.867	CD9 antigen
4	9606.ENSP00000482259	0.718	C-C motif chemokine 4
5	9606.ENSP00000296545	0.701	Interleukin-15
6	9606.ENSP00000474412	0.700	C-C motif chemokine 5
7	9606.ENSP00000306512	0.693	Interleukin-8
8	9606.ENSP00000302234	0.683	Eotaxin
9	9606.ENSP00000385675	0.681	Interleukin-6
10	9606.ENSP00000477908	0.681	C-C motif chemokine 3
11	9606.ENSP00000403495	0.680	Lymphotoxin-alpha
12	9606.ENSP00000398698	0.673	Tumor necrosis factor
13	9606.ENSP00000412237	0.673	Interleukin-10
14	9606.ENSP00000263341	0.671	Interleukin-1 beta
15	9606.ENSP00000225831	0.669	C-C motif chemokine 2
16	9606.ENSP00000305651	0.669	C-X-C motif chemokine 10
17	9606.ENSP00000344192	0.669	Interleukin-17A
18	9606.ENSP00000280357	0.662	Interleukin-18
19	9606.ENSP00000304915	0.662	Interleukin-13
20	9606.ENSP00000263339	0.658	Interleukin-1 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0042609	0.518	CD4 receptor binding
GO:0098772	0.448	molecular function regulator activity
GO:0048018	0.442	receptor ligand activity
GO:0005125	0.382	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0048584	0.985	positive regulation of response to stimulus
GO:0009987	0.983	cellular process
GO:0032101	0.974	regulation of response to external stimulus
GO:0051716	0.970	cellular response to stimulus
GO:0050794	0.960	regulation of cellular process
GO:0051239	0.934	regulation of multicellular organismal process
GO:0010604	0.929	positive regulation of macromolecule metabolic process
GO:0001819	0.922	positive regulation of cytokine production
GO:0002376	0.910	immune system process
GO:0007154	0.883	cell communication
GO:0048522	0.871	positive regulation of cellular process
GO:0023052	0.865	signaling
GO:0007165	0.826	signal transduction
GO:0032103	0.823	positive regulation of response to external stimulus
GO:0042221	0.777	response to chemical
GO:0006955	0.717	immune response
GO:0051049	0.600	regulation of transport
GO:0002682	0.530	regulation of immune system process
GO:0070887	0.526	cellular response to chemical stimulus
GO:0002684	0.509	positive regulation of immune system process
GO:0010033	0.497	response to organic substance
GO:0032501	0.493	multicellular organismal process
GO:0009605	0.460	response to external stimulus
GO:0007166	0.458	cell surface receptor signaling pathway
GO:0080134	0.432	regulation of response to stress
GO:0071345	0.351	cellular response to cytokine stimulus
GO:0040017	0.344	positive regulation of locomotion
GO:0032502	0.321	developmental process
GO:0006935	0.309	chemotaxis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0005622	0.999	intracellular anatomical structure
GO:0043227	0.996	membrane-bounded organelle
GO:0070013	0.993	intracellular organelle lumen
GO:0005576	0.990	extracellular region
GO:0005886	0.988	plasma membrane
GO:0005634	0.987	nucleus
GO:0031981	0.974	nuclear lumen
GO:0005829	0.958	cytosol
GO:0005654	0.952	nucleoplasm
GO:0005615	0.948	extracellular space
GO:0030054	0.679	cell junction
GO:0031982	0.536	vesicle
GO:0070161	0.525	anchoring junction
GO:0005925	0.425	focal adhesion
GO:0016604	0.360	nuclear body
GO:0016607	0.346	nuclear speck
GO:0030312	0.323	external encapsulating structure
GO:0062023	0.306	collagen-containing extracellular matrix
GO:0030496	0.302	midbody

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]