StarFunc result for job id Q14008

User Input

>input (2032 residues)
MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDS
NAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIE
KGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAV
RDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEA
KLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEAL
ESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAVGLRKKFGQYAG
HVVPTILEKFKEKKPQVVQALQEAIDAIFLTTTLQNISEDVLAVMDNKNPTIKQQTSLFI
ARSFRHCTASTLPKSLLKPFCAALLKHINDSAPEVRDAAFEALGTALKVVGEKAVNPFLA
DVDKLKLDKIKECSEKVELIHGKKAGLAADKKEFKPLPGRTAASGAAGDKDTKDISAPKP
GPLKKAPAAKAGGPPKKGKPAAPGGAGNTGTKNKKGLETKEIVEPELSIEVCEEKASAVL
PPTCIQLLDSSNWKERLACMEEFQKAVELMDRTEMPCQALVRMLAKKPGWKETNFQVMQM
KLHIVALIAQKGNFSKTSAQVVLDGLVDKIGDVKCGNNAKEAMTAIAEACMLPWTAEQVV
SMAFSQKNPKNQSETLNWLSNAIKEFGFSGLNVKAFISNVKTALAATNPAVRTAAITLLG
VMYLYVGPSLRMFFEDEKPALLSQIDAEFEKMQGQSPPAPTRGISKHSTSGTDEGEDGDE
PDDGSNDVVDLLPRTEISDKITSELVSKIGDKNWKIRKEGLDEVAGIINDAKFIQPNIGE
LPTALKGRLNDSNKILVQQTLNILQQLAVAMGPNIKQHVKNLGIPIITVLGDSKNNVRAA
ALATVNAWAEQTGMKEWLEGEDLSEELKKENPFLRQELLGWLAEKLPTLRSTPTDLILCV
PHLYSCLEDRNGDVRKKAQDALPFFMMHLGYEKMAKATGKLKPTSKDQVLAMLEKAKVNM
PAKPAPPTKATSKPMGGSAPAKFQPASAPAEDCISSSTEPKPDPKKAKAPGLSSKAKSAQ
GKKMPSKTSLKEDEDKSGPIFIVVPNGKEQRMKDEKGLKVLKWNFTTPRDEYIEQLKTQM
SSCVAKWLQDEMFHSDFQHHNKALAVMVDHLESEKEGVIGCLDLILKWLTLRFFDTNTSV
LMKALEYLKLLFTLLSEEEYHLTENEASSFIPYLVVKVGEPKDVIRKDVRAILNRMCLVY
PASKMFPFIMEGTKSKNSKQRAECLEELGCLVESYGMNVCQPTPGKALKEIAVHIGDRDN
AVRNAALNTIVTVYNVHGDQVFKLIGNLSEKDMSMLEERIKRSAKRPSAAPIKQVEEKPQ
RAQNISSNANMLRKGPAEDMSSKLNQARSMSGHPEAAQMVRREFQLDLDEIENDNGTVRC
EMPELVQHKLDDIFEPVLIPEPKIRAVSPHFDDMHSNTASTINFIISQVASGDINTSIQA
LTQIDEVLRQEDKAEAMSGHIDQFLIATFMQLRLIYNTHMADEKLEKDEIIKLYSCIIGN
MISLFQIESLAREASTGVLKDLMHGLITLMLDSRIEDLEEGQQVIRSVNLLVVKVLEKSD
QTNILSALLVLLQDSLLATASSPKFSELVMKCLWRMVRLLPDTINSINLDRILLDIHIFM
KVFPKEKLKQCKSEFPIRTLKTLLHTLCKLKGPKILDHLTMIDNKNESELEAHLCRMMKH
SMDQTGSKSDKETEKGASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKY
SDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVS
SIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRPPLTSLLSKPAVPTVASSTDMLHS
KLSQLRESREQHQHSDLDSNQTHSSGTVTSSSSTANIDDLKKRLERIKSSRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AGT5	0.839	0.839	0.000	2032	0.949	0.949	A2AGT5.pdb.gz	CKAP5_MOUSE Cytoskeleton-associated protein 5 OS=Mus musculus OX=10090 GN=Ckap5 PE=1 SV=1
2	AFDB:Q9VEZ3	0.392	0.390	0.000	2042	0.397	0.395	Q9VEZ3.pdb.gz	MSPS_DROME Protein mini spindles OS=Drosophila melanogaster OX=7227 GN=msps PE=1 SV=3
3	AFDB:Q94FN2	0.215	0.221	2.182E-85	1978	0.273	0.281	Q94FN2.pdb.gz	MOR1_ARATH Protein MOR1 OS=Arabidopsis thaliana OX=3702 GN=MOR1 PE=1 SV=1
4	AFDB:Q1ZXQ8	0.243	0.245	5.619E-80	2013	0.250	0.253	Q1ZXQ8.pdb.gz	MTAA_DICDI Centrosomal protein 224 OS=Dictyostelium discoideum OX=44689 GN=mtaA PE=1 SV=1
5	AFDB:G5EEM5	0.146	0.204	1.055E-48	1415	0.181	0.259	G5EEM5.pdb.gz	ZYG9_CAEEL Zygote defective protein 9 OS=Caenorhabditis elegans OX=6239 GN=zyg-9 PE=1 SV=1
6	AFDB:Q5B1Q9	0.204	0.427	6.977E-27	891	0.099	0.227	Q5B1Q9.pdb.gz	Q5B1Q9_EMENI Dis1/XMAP215 protein AlpA (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=alpA PE=4 SV=1
7	AFDB:Q17423	0.120	0.176	1.433E-20	1282	0.088	0.139	Q17423.pdb.gz	CREC_CAEEL Crescerin-like protein che-12 OS=Caenorhabditis elegans OX=6239 GN=che-12 PE=1 SV=3
8	AFDB:Q09933	0.111	0.250	6.271E-18	882	0.073	0.169	Q09933.pdb.gz	DIS1_SCHPO Phosphoprotein p93 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis1 PE=1 SV=1
9	AFDB:E9PVA8	0.111	0.089	3.078E-16	2671	0.120	0.091	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
10	PDB:4a0cA	0.133	0.191	7.013E-13	1155	0.072	0.126	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
11	PDB:7mq8LM	0.096	0.096	9.401E-12	2005	0.119	0.120	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mqaSP	0.095	0.084	1.640E-11	2485	0.101	0.082	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:6bcuA	0.144	0.138	1.702E-11	2204	0.112	0.103	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
14	PDB:6zwmB	0.117	0.113	1.702E-11	2185	0.107	0.099	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
15	PDB:7mq8SP	0.088	0.089	2.559E-11	1993	0.104	0.106	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:4jlqA	0.119	0.220	3.196E-11	840	0.053	0.129	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
17	PDB:7sukSP	0.097	0.091	4.631E-11	2234	0.103	0.094	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
18	PDB:3w3uA	0.145	0.231	5.176E-11	1030	0.083	0.163	3w3uA.pdb.gz
19	AFDB:Q86Y56	0.101	0.181	6.345E-11	855	0.059	0.140	Q86Y56.pdb.gz	DAAF5_HUMAN Dynein axonemal assembly factor 5 OS=Homo sapiens OX=9606 GN=DNAAF5 PE=1 SV=4
20	PDB:6xu2A	0.136	0.221	6.465E-11	1091	0.076	0.142	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AGT5	0.0	3872	2032	0.949	0.949	CKAP5_MOUSE Cytoskeleton-associated protein 5 OS=Mus musculus OX=10090 GN=Ckap5 PE=1 SV=1
2	Q14008	0.0	4169	2032	1.000	1.000	CKAP5_HUMAN Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3
3	Q32Q01	0.0	1076	535	0.257	0.978	Q32Q01_RAT Ckap5 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ckap5 PE=2 SV=1
4	Q9VEZ3	0.0	1203	2042	0.332	0.330	MSPS_DROME Protein mini spindles OS=Drosophila melanogaster OX=7227 GN=msps PE=1 SV=3
5	Q94FN2	7.12e-176	590	1978	0.214	0.220	MOR1_ARATH Protein MOR1 OS=Arabidopsis thaliana OX=3702 GN=MOR1 PE=1 SV=1
6	Q1ZXQ8	1.76e-126	445	2013	0.164	0.165	MTAA_DICDI Centrosomal protein 224 OS=Dictyostelium discoideum OX=44689 GN=mtaA PE=1 SV=1
7	H0YEK7	1.17e-117	372	190	0.089	0.953	H0YEK7_HUMAN Cytoskeleton associated protein 5 (Fragment) OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=2
8	H0YCF6	9.92e-95	305	166	0.077	0.940	H0YCF6_HUMAN Cytoskeleton associated protein 5 (Fragment) OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=8
9	Q5B1Q9	8.26e-87	307	891	0.094	0.215	Q5B1Q9_EMENI Dis1/XMAP215 protein AlpA (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=alpA PE=4 SV=1
10	O94534	3.41e-78	280	809	0.087	0.218	ALP14_SCHPO Spindle pole body component alp14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp14 PE=1 SV=1
11	G5EEM5	6.74e-58	224	1415	0.084	0.120	ZYG9_CAEEL Zygote defective protein 9 OS=Caenorhabditis elegans OX=6239 GN=zyg-9 PE=1 SV=1
12	Q09933	2.81e-43	174	882	0.069	0.159	DIS1_SCHPO Phosphoprotein p93 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dis1 PE=1 SV=1
13	P46675	5.29e-35	148	888	0.072	0.164	STU2_YEAST Protein STU2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STU2 PE=1 SV=1
14	Q583M5	4.70e-09	64.3	1621	0.033	0.042	Q583M5_TRYB2 TOG domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.840 PE=3 SV=1
15	Q9NBD7	2.76e-06	55.5	1491	0.027	0.036	CLASP_DROME CLIP-associating protein OS=Drosophila melanogaster OX=7227 GN=chb PE=1 SV=1
16	E7ERI8	5.34e-06	54.3	1513	0.025	0.034	E7ERI8_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
17	E7EW49	5.53e-06	54.3	1514	0.025	0.034	E7EW49_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
18	A0A8I6AEZ5	5.77e-05	50.8	1555	0.026	0.034	A0A8I6AEZ5_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=1
19	F1LNQ9	6.53e-05	50.8	1539	0.026	0.034	F1LNQ9_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
20	Q7Z460	6.53e-05	50.8	1538	0.026	0.034	CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12348 CLASP_N	6.9e-35	132.2	CLASP N terminal
2	PF12717 Cnd1	1.3e-06	40.0	non-SMC mitotic condensation complex subunit 1
3	PF12765 Cohesin_HEAT	1.8e+02	13.8	HEAT repeat associated with sister chromatid cohesion
4	PF06378 DUF1071	2.1e+02	12.9	Protein of unknown function (DUF1071)
5	PF02985 HEAT	2.7e-12	56.8	HEAT repeat
6	PF13646 HEAT_2	2.8e-07	42.2	HEAT repeats
7	PF13513 HEAT_EZ	7.4e+02	12.1	HEAT-like repeat
8	PF10274 ParcG	2.4e+02	13.3	Parkin co-regulated protein
9	PF11640 TAN	3.6	19.1	Telomere-length maintenance and DNA damage repair
10	PF12755 Vac14_Fab1_bd	0.22	23.5	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000432768

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326550	0.999	Transforming acidic coiled-coil-containing protein 3
2	9606.ENSP00000321703	0.996	Transforming acidic coiled-coil-containing protein 1
3	9606.ENSP00000261597	0.989	Kinetochore protein NDC80 homolog
4	9606.ENSP00000216911	0.988	Aurora kinase A
5	9606.ENSP00000264313	0.970	SLAIN motif-containing protein 2
6	9606.ENSP00000358001	0.969	Transforming acidic coiled-coil-containing protein 2
7	9606.ENSP00000380378	0.962	Platelet-activating factor acetylhydrolase IB subunit alpha
8	9606.ENSP00000408910	0.951	Dynactin subunit 2
9	9606.ENSP00000233121	0.950	Microtubule-associated protein RP/EB family member 3
10	9606.ENSP00000379975	0.948	Integrin-linked protein kinase
11	9606.ENSP00000364721	0.945	Microtubule-associated protein RP/EB family member 1
12	9606.ENSP00000417518	0.928	CLIP-associating protein 2
13	9606.ENSP00000347444	0.912	Tudor domain-containing protein 7
14	9606.ENSP00000260731	0.910	Kinesin-like protein KIF11
15	9606.ENSP00000302530	0.906	Mitotic checkpoint serine/threonine-protein kinase BUB1
16	9606.ENSP00000265148	0.905	Centromere-associated protein E
17	9606.ENSP00000287598	0.897	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
18	9606.ENSP00000200135	0.892	Centromere/kinetochore protein zw10 homolog
19	9606.ENSP00000357858	0.883	Mitotic checkpoint protein BUB3
20	9606.ENSP00000300093	0.873	Serine/threonine-protein kinase PLK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0044877	0.998	protein-containing complex binding
GO:0043021	0.994	ribonucleoprotein complex binding
GO:0045296	0.992	cadherin binding
GO:0003824	0.380	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044085	0.982	cellular component biogenesis
GO:0050794	0.978	regulation of cellular process
GO:0043933	0.958	protein-containing complex organization
GO:0051128	0.953	regulation of cellular component organization
GO:0048522	0.942	positive regulation of cellular process
GO:0022607	0.922	cellular component assembly
GO:0006996	0.838	organelle organization
GO:0022402	0.756	cell cycle process
GO:0000226	0.718	microtubule cytoskeleton organization
GO:0051179	0.597	localization
GO:0065003	0.578	protein-containing complex assembly
GO:0033043	0.495	regulation of organelle organization
GO:0051130	0.456	positive regulation of cellular component organization
GO:0007051	0.343	spindle organization
GO:0051641	0.339	cellular localization
GO:0000278	0.328	mitotic cell cycle
GO:1903047	0.307	mitotic cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0099080	0.999	supramolecular complex
GO:0005737	0.999	cytoplasm
GO:0015630	0.998	microtubule cytoskeleton
GO:0031981	0.995	nuclear lumen
GO:0099513	0.993	polymeric cytoskeletal fiber
GO:0005829	0.992	cytosol
GO:0016020	0.981	membrane
GO:0005874	0.954	microtubule
GO:0032991	0.952	protein-containing complex
GO:0005815	0.932	microtubule organizing center
GO:0005694	0.916	chromosome
GO:0005813	0.901	centrosome
GO:0005819	0.892	spindle
GO:0071944	0.883	cell periphery
GO:0098687	0.845	chromosomal region
GO:0005654	0.833	nucleoplasm
GO:0000793	0.809	condensed chromosome
GO:0005886	0.773	plasma membrane
GO:0120025	0.735	plasma membrane bounded cell projection
GO:0000776	0.590	kinetochore
GO:0043005	0.544	neuron projection
GO:0000922	0.537	spindle pole
GO:0099568	0.533	cytoplasmic region
GO:0032838	0.521	plasma membrane bounded cell projection cytoplasm
GO:0035770	0.514	ribonucleoprotein granule
GO:0036464	0.427	cytoplasmic ribonucleoprotein granule
GO:0030425	0.426	dendrite
GO:0044297	0.424	cell body
GO:0005730	0.418	nucleolus
GO:0043025	0.391	neuronal cell body
GO:0071598	0.355	neuronal ribonucleoprotein granule
GO:0043204	0.311	perikaryon
GO:1990752	0.304	microtubule end
GO:0012505	0.301	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]