StarFunc result for job id Q14012

User Input

>input (370 residues)
MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGT
ELSPTLPHQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63450	0.901	0.892	2.841E-65	374	0.973	0.963	Q63450.pdb.gz	KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2
2	AFDB:E7F1H0	0.860	0.834	3.874E-53	382	0.786	0.762	E7F1H0.pdb.gz	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1
3	AFDB:Q8BW96	0.859	0.827	2.540E-52	385	0.732	0.704	Q8BW96.pdb.gz	KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2
4	AFDB:A1L290	0.790	0.746	3.056E-49	392	0.695	0.656	A1L290.pdb.gz
5	AFDB:B1H1J7	0.774	0.664	2.373E-47	433	0.695	0.594	B1H1J7.pdb.gz	B1H1J7_DANRE Calcium/calmodulin-dependent protein kinase type 1D OS=Danio rerio OX=7955 GN=zgc:172284 PE=2 SV=1
6	AFDB:Q91VB2	0.829	0.647	5.964E-46	477	0.614	0.476	Q91VB2.pdb.gz	KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus OX=10090 GN=Camk1g PE=1 SV=1
7	AFDB:F1QB46	0.783	0.671	5.399E-45	433	0.595	0.508	F1QB46.pdb.gz	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
8	AFDB:W0LYS5	0.802	0.860	9.749E-45	345	0.611	0.655	W0LYS5.pdb.gz	CAMKI_MACNP Calcium/calmodulin-dependent protein kinase type 1 OS=Macrobrachium nipponense OX=159736 GN=CaMKI PE=2 SV=1
9	AFDB:O70150	0.813	0.876	1.420E-44	343	0.592	0.638	O70150.pdb.gz	KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus OX=10116 GN=Pnck PE=1 SV=1
10	AFDB:Q7JMV3	0.765	0.700	8.430E-43	405	0.573	0.523	Q7JMV3.pdb.gz	Q7JMV3_DROME Calcium/calmodulin dependent protein kinase I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
11	PDB:8bfsA	0.715	0.958	1.028E-41	274	0.619	0.836	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
12	PDB:5u6yA	0.681	0.552	1.561E-29	459	0.354	0.285	5u6yA.pdb.gz
13	PDB:2yaaA	0.681	0.835	1.251E-23	300	0.303	0.373	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
14	PDB:3soaA	0.664	0.568	1.251E-23	436	0.308	0.261	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
15	PDB:4rgjA	0.661	0.533	5.676E-22	463	0.295	0.235	4rgjA.pdb.gz
16	PDB:6b1uA	0.613	0.517	3.026E-20	442	0.292	0.244	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
17	PDB:4d28C	0.611	0.797	3.959E-20	279	0.270	0.358	4d28C.pdb.gz
18	PDB:4cztD	0.605	0.732	4.652E-20	302	0.278	0.341	4cztD.pdb.gz
19	PDB:4zhxA	0.612	0.556	5.179E-20	409	0.281	0.254	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:7myjC	0.613	0.492	5.465E-20	465	0.305	0.243	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1H1J7	0.0	544	433	0.700	0.598	B1H1J7_DANRE Calcium/calmodulin-dependent protein kinase type 1D OS=Danio rerio OX=7955 GN=zgc:172284 PE=2 SV=1
2	B5MF71	0.0	538	368	0.689	0.693	B5MF71_DANRE Calcium/calmodulin-dependent protein kinase 1Db OS=Danio rerio OX=7955 GN=camk1d PE=2 SV=1
3	B5MF72	0.0	539	392	0.689	0.651	B5MF72_DANRE Calcium/calmodulin-dependent protein kinase 1Db OS=Danio rerio OX=7955 GN=camk1d PE=2 SV=1
4	E7F1H0	0.0	596	382	0.773	0.749	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1
5	Q14012	0.0	768	370	1.000	1.000	KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1
6	Q63450	0.0	747	374	0.973	0.963	KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2
7	Q8BW96	0.0	563	385	0.719	0.691	KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2
8	Q8IU85	0.0	558	385	0.716	0.688	KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D PE=1 SV=1
9	Q91YS8	0.0	745	374	0.970	0.960	KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1
10	O70150	1.32e-166	471	343	0.597	0.644	KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus OX=10116 GN=Pnck PE=1 SV=1
11	F1QB46	2.93e-164	468	433	0.595	0.508	F1QB46_DANRE Calcium/calmodulin-dependent protein kinase IG isoform X3 OS=Danio rerio OX=7955 GN=wu:fk61c03 PE=3 SV=1
12	Q6P965	3.37e-164	468	433	0.595	0.508	Q6P965_DANRE Calcium/calmodulin-dependent protein kinase IG OS=Danio rerio OX=7955 GN=zgc:73155 PE=2 SV=1
13	W0LYS5	1.89e-161	457	345	0.597	0.641	CAMKI_MACNP Calcium/calmodulin-dependent protein kinase type 1 OS=Macrobrachium nipponense OX=159736 GN=CaMKI PE=2 SV=1
14	Q96NX5	2.40e-160	460	476	0.595	0.462	KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens OX=9606 GN=CAMK1G PE=1 SV=3
15	Q7TNJ7	7.71e-160	458	476	0.597	0.464	KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus OX=10116 GN=Camk1g PE=2 SV=1
16	Q91VB2	8.70e-160	458	477	0.597	0.463	KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus OX=10090 GN=Camk1g PE=1 SV=1
17	Q9TXJ0	1.03e-154	441	348	0.578	0.615	CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans OX=6239 GN=cmk-1 PE=1 SV=1
18	A4V110	2.87e-152	436	390	0.559	0.531	A4V110_DROME Calcium/calmodulin-dependent protein kinase I, isoform I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
19	Q7JMV3	7.81e-148	425	405	0.559	0.511	Q7JMV3_DROME Calcium/calmodulin dependent protein kinase I OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1
20	Q0KIF7	4.26e-125	363	284	0.449	0.585	Q0KIF7_DROME Calcium/calmodulin-dependent protein kinase I, isoform H OS=Drosophila melanogaster OX=7227 GN=CaMKI PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	31	15.8	Phosphotransferase enzyme family
2	PF06293 Kdo	14	16.5	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF14531 Kinase-like	0.0018	29.3	Kinase-like
4	PF00069 Pkinase	1.2e-74	262.6	Protein kinase domain
5	PF17667 Pkinase_fungal	19	15.5	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	4e-35	132.9	Protein tyrosine and serine/threonine kinase
7	PF01163 RIO1	1.8e+02	13.1	RIO1 family
8	PF00264 Tyrosinase	2.5e+02	13.3	Common central domain of tyrosinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000256460

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272298	0.976	Calmodulin 2 (phosphorylase kinase, delta)
2	9606.ENSP00000291295	0.975	Calmodulin 3 (phosphorylase kinase, delta)
3	9606.ENSP00000349467	0.963	Calmodulin-1
4	9606.ENSP00000312741	0.962	Calcium/calmodulin-dependent protein kinase kinase 2
5	9606.ENSP00000158166	0.947	Calcium/calmodulin-dependent protein kinase kinase 1
6	9606.ENSP00000364893	0.928	Rho guanine nucleotide exchange factor 7
7	9606.ENSP00000263212	0.917	Protein phosphatase 1F
8	9606.ENSP00000378338	0.912	ARF GTPase-activating protein GIT1
9	9606.ENSP00000387699	0.873	Cyclic AMP-responsive element-binding protein 1
10	9606.ENSP00000297494	0.849	Nitric oxide synthase, endothelial
11	9606.ENSP00000262053	0.720	Cyclic AMP-dependent transcription factor ATF-1
12	9606.ENSP00000427120	0.720	Small conductance calcium-activated potassium channel protein 2
13	9606.ENSP00000295987	0.681	Synapsin-1
14	9606.ENSP00000419081	0.675	Calmodulin-like protein 4
15	9606.ENSP00000412326	0.665	cAMP-regulated phosphoprotein 21
16	9606.ENSP00000369689	0.661	Calmodulin-like protein 5
17	9606.ENSP00000304643	0.658	Calmodulin-like protein 6
18	9606.ENSP00000315299	0.658	Calmodulin-like protein 3
19	9606.ENSP00000376930	0.644	Endoplasmic reticulum membrane protein that promotes endoplasmic reticulum-associated endosome fission . Localizes to contact sites between the endoplasmic reticulum and endosomes and acts by promoting recruitment of the endoplasmic reticulum to endosome tubules for fission . Endosome membrane fission of early and late endosomes is essential to separate regions destined for lysosomal degradation from carriers to be recycled to the plasma membrane .
20	9606.ENSP00000225983	0.634	Histone deacetylase 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0004683	0.992	calmodulin-dependent protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.979	response to stimulus
GO:0008152	0.975	metabolic process
GO:0071704	0.970	organic substance metabolic process
GO:0048518	0.968	positive regulation of biological process
GO:0044237	0.967	cellular metabolic process
GO:0044238	0.959	primary metabolic process
GO:0043170	0.949	macromolecule metabolic process
GO:0006807	0.940	nitrogen compound metabolic process
GO:0006793	0.940	phosphorus metabolic process
GO:0060341	0.939	regulation of cellular localization
GO:0043412	0.929	macromolecule modification
GO:0032386	0.925	regulation of intracellular transport
GO:0009893	0.923	positive regulation of metabolic process
GO:0033157	0.920	regulation of intracellular protein transport
GO:1901564	0.916	organonitrogen compound metabolic process
GO:0016310	0.916	phosphorylation
GO:0006468	0.907	protein phosphorylation
GO:0051174	0.904	regulation of phosphorus metabolic process
GO:0046822	0.878	regulation of nucleocytoplasmic transport
GO:0046825	0.867	regulation of protein export from nucleus
GO:0048522	0.833	positive regulation of cellular process
GO:0080090	0.813	regulation of primary metabolic process
GO:0060255	0.798	regulation of macromolecule metabolic process
GO:0051171	0.793	regulation of nitrogen compound metabolic process
GO:0051716	0.742	cellular response to stimulus
GO:0065009	0.735	regulation of molecular function
GO:0010604	0.690	positive regulation of macromolecule metabolic process
GO:0051222	0.674	positive regulation of protein transport
GO:0031325	0.670	positive regulation of cellular metabolic process
GO:0050803	0.618	regulation of synapse structure or activity
GO:0090316	0.608	positive regulation of intracellular protein transport
GO:0046824	0.605	positive regulation of nucleocytoplasmic transport
GO:0051128	0.582	regulation of cellular component organization
GO:0051173	0.565	positive regulation of nitrogen compound metabolic process
GO:0007154	0.521	cell communication
GO:0023052	0.519	signaling
GO:0007165	0.460	signal transduction
GO:0009889	0.447	regulation of biosynthetic process
GO:0031326	0.415	regulation of cellular biosynthetic process
GO:0019219	0.405	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.395	regulation of gene expression
GO:0010556	0.395	regulation of macromolecule biosynthetic process
GO:0051252	0.371	regulation of RNA metabolic process
GO:0006355	0.363	regulation of DNA-templated transcription
GO:0019220	0.346	regulation of phosphate metabolic process
GO:0045937	0.315	positive regulation of phosphate metabolic process
GO:0051179	0.314	localization
GO:0050790	0.313	regulation of catalytic activity
GO:0031399	0.306	regulation of protein modification process
GO:0042325	0.302	regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.980	cytosol
GO:0070013	0.934	intracellular organelle lumen
GO:0043231	0.876	intracellular membrane-bounded organelle
GO:0005634	0.777	nucleus
GO:0031981	0.585	nuclear lumen
GO:0005654	0.570	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.17	0.992	calcium/calmodulin-dependent protein kinase.

[back to server]