StarFunc result for job id Q14031

User Input

>input (1691 residues)
MLINKLWLLLVTLCLTEELAAAGEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGP
TGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGP
PGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLD
GITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPG
PRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGN
PGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTI
GAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSG
FCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSG
PKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGE
KGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIP
GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEK
GLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSG
LPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISG
HPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKG
SVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRR
PMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPP
GFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGS
PGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGE
PGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPA
GLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGD
PGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGE
LGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPG
PLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQG
PPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEG
QEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQ
IPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVS
PGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTR
VSRCQVCMKSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AVK5	0.180	0.180	0.000	1691	0.797	0.797	B1AVK5.pdb.gz	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
2	AFDB:Q14031	1.000	1.000	0.000	1691	1.000	1.000	Q14031.pdb.gz	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
3	AFDB:F1QYN1	0.178	0.175	8.591E-77	1714	0.536	0.529	F1QYN1.pdb.gz
4	AFDB:P08572	0.191	0.189	2.913E-72	1712	0.516	0.510	P08572.pdb.gz	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
5	AFDB:F1M6Q3	0.160	0.163	6.500E-69	1645	0.501	0.516	F1M6Q3.pdb.gz	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4
6	AFDB:Q9QZR9	0.151	0.152	2.838E-68	1682	0.506	0.508	Q9QZR9.pdb.gz	CO4A4_MOUSE Collagen alpha-4(IV) chain OS=Mus musculus OX=10090 GN=Col4a4 PE=1 SV=1
7	AFDB:P53420	0.146	0.146	9.214E-66	1690	0.500	0.501	P53420.pdb.gz	CO4A4_HUMAN Collagen alpha-4(IV) chain OS=Homo sapiens OX=9606 GN=COL4A4 PE=1 SV=3
8	AFDB:P17140	0.163	0.157	2.253E-63	1758	0.492	0.473	P17140.pdb.gz	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
9	AFDB:Q63ZW6	0.180	0.180	2.523E-63	1691	0.504	0.504	Q63ZW6.pdb.gz	Q63ZW6_MOUSE Col4a5 protein OS=Mus musculus OX=10090 GN=Col4a5 PE=1 SV=1
10	AFDB:B0UXF7	0.154	0.155	5.629E-60	1679	0.493	0.497	B0UXF7.pdb.gz
11	PDB:4v96AS	0.021	0.073	1.524E-1	242	0.020	0.136	4v96AS.pdb.gz
12	PDB:5k1bA	0.028	0.101	3.996E-1	264	0.009	0.057	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
13	PDB:6u23A	0.031	0.061	2.189	583	0.020	0.057	6u23A.pdb.gz
14	PDB:8a7eC	0.029	0.031	2.452	1524	0.014	0.015	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
15	PDB:7ajtCL	0.024	0.042	3.076	781	0.009	0.020	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:1xe8B	0.030	0.136	3.647	193	0.010	0.088	1xe8B.pdb.gz	Crystal structure of the YML079w protein from Saccharomyces cerevisiae reveals a new sequence family of the jelly-roll fold
17	PDB:6xtx4	0.021	0.042	3.859	598	0.012	0.035	6xtx4.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
18	PDB:5iz5B	0.028	0.049	4.085	746	0.011	0.025	5iz5B.pdb.gz
19	PDB:6sh3A	0.024	0.064	4.085	376	0.004	0.019	6sh3A.pdb.gz	Structure of the Bcs1 AAA-ATPase suggests an airlock-like translocation mechanism for folded proteins.
20	PDB:7v3u6	0.030	0.060	4.323	646	0.015	0.039	7v3u6.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AHV3	0.0	855	1678	0.487	0.491	A0A8I6AHV3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=1
2	A0A8I6AVZ9	0.0	732	1619	0.408	0.426	A0A8I6AVZ9_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=1
3	B1AVK5	0.0	2080	1691	0.798	0.798	B1AVK5_MOUSE Collagen, type IV, alpha 6 OS=Mus musculus OX=10090 GN=Col4a6 PE=1 SV=1
4	F1M6Q3	0.0	924	1707	0.515	0.510	F1M6Q3_RAT Collagen type IV alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col4a2 PE=1 SV=4
5	F1MA59	0.0	622	1669	0.420	0.425	F1MA59_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1
6	F1RLL9	0.0	900	1712	0.517	0.511	F1RLL9_PIG Collagen type IV alpha 2 chain OS=Sus scrofa OX=9823 GN=COL4A2 PE=1 SV=3
7	P08120	0.0	849	1779	0.452	0.429	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
8	P08122	0.0	944	1707	0.511	0.506	CO4A2_MOUSE Collagen alpha-2(IV) chain OS=Mus musculus OX=10090 GN=Col4a2 PE=1 SV=4
9	P08572	0.0	726	1712	0.325	0.321	CO4A2_HUMAN Collagen alpha-2(IV) chain OS=Homo sapiens OX=9606 GN=COL4A2 PE=1 SV=4
10	P17139	0.0	785	1759	0.471	0.453	CO4A1_CAEEL Collagen alpha-1(IV) chain OS=Caenorhabditis elegans OX=6239 GN=emb-9 PE=1 SV=5
11	P17140	0.0	741	1758	0.489	0.470	CO4A2_CAEEL Collagen alpha-2(IV) chain OS=Caenorhabditis elegans OX=6239 GN=let-2 PE=1 SV=2
12	Q14031	0.0	3060	1691	1.000	1.000	CO4A6_HUMAN Collagen alpha-6(IV) chain OS=Homo sapiens OX=9606 GN=COL4A6 PE=1 SV=3
13	Q6PFB1	0.0	1132	1115	0.497	0.753	Q6PFB1_MOUSE Col4a6 protein OS=Mus musculus OX=10090 GN=Col4a6 PE=2 SV=1
14	Q9ESQ1	0.0	2074	1691	0.797	0.797	Q9ESQ1_MOUSE Type IV collagen alpha 6 chain OS=Mus musculus OX=10090 GN=Col4a6 PE=2 SV=1
15	Q9VMV5	0.0	702	1940	0.425	0.371	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
16	P02463	6.12e-180	588	1669	0.327	0.331	CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus OX=10090 GN=Col4a1 PE=1 SV=4
17	P02462	1.56e-177	582	1669	0.389	0.394	CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens OX=9606 GN=COL4A1 PE=1 SV=4
18	Q9QZS0	2.70e-138	472	1669	0.351	0.355	CO4A3_MOUSE Collagen alpha-3(IV) chain OS=Mus musculus OX=10090 GN=Col4a3 PE=1 SV=2
19	Q01955	2.13e-120	420	1670	0.217	0.220	CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens OX=9606 GN=COL4A3 PE=1 SV=3
20	A0A8I6AFK7	2.51e-113	397	1562	0.281	0.305	A0A8I6AFK7_RAT Collagen type IV alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col4a1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01413 C4	2.4e-79	274.3	C-terminal tandem repeated domain in type 4 procollagen
2	PF01391 Collagen	3.5e-186	614.5	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378340

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331902	0.963	Collagen alpha-5(IV) chain
2	9606.ENSP00000379350	0.937	Integrin beta-1
3	9606.ENSP00000452786	0.933	Integrin beta-3
4	9606.ENSP00000263556	0.918	Prolyl 4-hydroxylase subunit alpha-1
5	9606.ENSP00000353654	0.918	Collagen alpha-2(IV) chain
6	9606.ENSP00000364979	0.918	Collagen alpha-1(IV) chain
7	9606.ENSP00000261023	0.916	Integrin alpha-V
8	9606.ENSP00000296585	0.915	Integrin alpha-2
9	9606.ENSP00000379823	0.915	Collagen alpha-3(IV) chain
10	9606.ENSP00000379866	0.915	Collagen alpha-4(IV) chain
11	9606.ENSP00000370542	0.909	Syndecan-1
12	9606.ENSP00000354238	0.908	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
13	9606.ENSP00000401749	0.908	Prolyl 4-hydroxylase subunit alpha-3
14	9606.ENSP00000282588	0.907	Integrin alpha-1
15	9606.ENSP00000384999	0.907	Prolyl 4-hydroxylase subunit alpha-2
16	9606.ENSP00000253496	0.903	Coagulation factor XII
17	9606.ENSP00000226284	0.900	Bone sialoprotein 2
18	9606.ENSP00000351273	0.900	Caspase-8
19	9606.ENSP00000355361	0.900	Leukocyte surface antigen CD47
20	9606.ENSP00000363973	0.900	Alkaline phosphatase, tissue-nonspecific isozyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	1.000	extracellular matrix structural constituent
GO:0030020	0.985	extracellular matrix structural constituent conferring tensile strength

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0007169	0.978	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0071229	0.961	cellular response to acid chemical
GO:0043200	0.961	response to amino acid
GO:0045229	0.945	external encapsulating structure organization
GO:0030198	0.941	extracellular matrix organization
GO:0071495	0.916	cellular response to endogenous stimulus
GO:1901699	0.874	cellular response to nitrogen compound
GO:0071230	0.827	cellular response to amino acid stimulus
GO:0032502	0.570	developmental process
GO:0032501	0.551	multicellular organismal process
GO:0048856	0.550	anatomical structure development
GO:0007275	0.359	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0032991	0.998	protein-containing complex
GO:0005576	0.987	extracellular region
GO:0005737	0.985	cytoplasm
GO:0012505	0.978	endomembrane system
GO:0043227	0.977	membrane-bounded organelle
GO:0070013	0.974	intracellular organelle lumen
GO:0005581	0.970	collagen trimer
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0099081	0.958	supramolecular polymer
GO:0005604	0.944	basement membrane
GO:0098644	0.941	complex of collagen trimers
GO:0005587	0.930	collagen type IV trimer
GO:0005788	0.908	endoplasmic reticulum lumen
GO:0016020	0.564	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]