StarFunc result for job id Q14032

User Input

>input (418 residues)
MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYRANEFGEVDL
NHASSLGGDYMGVHPMGLFWSLKPEKLLTRLLKRDVMNRPFQVQVKLYDLELIVNNKVAS
APKASLTLERWYVAPGVTRIKVREGRLRGALFLPPGEGLFPGVIDLFGGLGGLLEFRASL
LASRGFASLALAYHNYEDLPRKPEVTDLEYFEEAANFLLRHPKVFGSGVGVVSVCQGVQI
GLSMAIYLKQVTATVLINGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFE
TTQVGASQYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLLSYPGA
GHLIEPPYSPLCCASTTHDLRLHWGGEVIPHAAAQEHAWKEIQRFLRKHLIPDVTSQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14032	1.000	1.000	6.290E-95	418	1.000	1.000	Q14032.pdb.gz	BAAT_HUMAN Bile acid-CoA:amino acid N-acyltransferase OS=Homo sapiens OX=9606 GN=BAAT PE=1 SV=1
2	AFDB:Q91X34	0.982	0.977	6.595E-74	420	0.694	0.690	Q91X34.pdb.gz	BAAT_MOUSE Bile acid-CoA:amino acid N-acyltransferase OS=Mus musculus OX=10090 GN=Baat PE=1 SV=1
3	AFDB:Q63276	0.975	0.971	8.785E-72	420	0.699	0.695	Q63276.pdb.gz	BAAT_RAT Bile acid-CoA:amino acid N-acyltransferase OS=Rattus norvegicus OX=10116 GN=Baat PE=1 SV=2
4	AFDB:A2AKK5	0.965	0.969	1.168E-64	416	0.548	0.550	A2AKK5.pdb.gz	ACNT1_MOUSE Acyl-coenzyme A amino acid N-acyltransferase 1 OS=Mus musculus OX=10090 GN=Acnat1 PE=1 SV=1
5	AFDB:Q8BWN8	0.948	0.941	8.722E-57	421	0.414	0.411	Q8BWN8.pdb.gz	ACOT4_MOUSE Peroxisomal succinyl-coenzyme A thioesterase OS=Mus musculus OX=10090 GN=Acot4 PE=1 SV=1
6	AFDB:P49753	0.932	0.809	1.843E-56	483	0.435	0.377	P49753.pdb.gz	ACOT2_HUMAN Acyl-coenzyme A thioesterase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT2 PE=1 SV=6
7	AFDB:Q8N9L9	0.939	0.933	2.757E-56	421	0.438	0.435	Q8N9L9.pdb.gz	ACOT4_HUMAN Peroxisomal succinyl-coenzyme A thioesterase OS=Homo sapiens OX=9606 GN=ACOT4 PE=1 SV=2
8	AFDB:Q9QYR7	0.935	0.905	7.335E-56	432	0.423	0.410	Q9QYR7.pdb.gz	ACOT3_MOUSE Acyl-coenzyme A thioesterase 3 OS=Mus musculus OX=10090 GN=Acot3 PE=1 SV=1
9	AFDB:O55171	0.936	0.865	9.781E-56	453	0.411	0.380	O55171.pdb.gz	ACOT2_RAT Acyl-coenzyme A thioesterase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acot2 PE=1 SV=1
10	AFDB:O55137	0.946	0.944	1.951E-55	419	0.407	0.406	O55137.pdb.gz	ACOT1_MOUSE Acyl-coenzyme A thioesterase 1 OS=Mus musculus OX=10090 GN=Acot1 PE=1 SV=1
11	PDB:3hlkB	0.930	0.945	5.973E-55	411	0.433	0.440	3hlkB.pdb.gz
12	PDB:3k2iA	0.932	0.962	7.961E-54	405	0.435	0.449	3k2iA.pdb.gz
13	PDB:7jn7A	0.402	0.216	1.848E-9	846	0.160	0.079	7jn7A.pdb.gz	Dipeptidyl peptidase 9 sets a threshold for CARD8 inflammasome formation by sequestering its active C-terminal fragment.
14	PDB:2gbfA	0.414	0.250	1.165E-8	730	0.136	0.078	2gbfA.pdb.gz	Crystal Structures of DPP-IV (CD26) from Rat Kidney Exhibit Flexible Accommodation of Peptidase-Selective Inhibitors.
15	PDB:6eorB	0.418	0.233	2.195E-8	805	0.139	0.072	6eorB.pdb.gz	Structures and mechanism of dipeptidyl peptidases 8 and 9, important players in cellular homeostasis and cancer.
16	PDB:4n8eB	0.408	0.244	3.903E-8	734	0.146	0.083	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.
17	PDB:6y0fC	0.411	0.252	5.512E-8	722	0.124	0.072	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
18	PDB:7ayqA	0.411	0.228	9.253E-8	808	0.115	0.059	7ayqA.pdb.gz	Chemoproteomics-Enabled Identification of 4-Oxo-beta-Lactams as Inhibitors of Dipeptidyl Peptidases 8 and 9.
19	PDB:4wjlB	0.425	0.263	1.466E-7	719	0.153	0.089	4wjlB.pdb.gz
20	PDB:3kxpA	0.346	0.516	7.347E-7	268	0.098	0.153	3kxpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14032	0.0	859	418	1.000	1.000	BAAT_HUMAN Bile acid-CoA:amino acid N-acyltransferase OS=Homo sapiens OX=9606 GN=BAAT PE=1 SV=1
2	Q63276	0.0	594	420	0.699	0.695	BAAT_RAT Bile acid-CoA:amino acid N-acyltransferase OS=Rattus norvegicus OX=10116 GN=Baat PE=1 SV=2
3	Q91X34	0.0	598	420	0.694	0.690	BAAT_MOUSE Bile acid-CoA:amino acid N-acyltransferase OS=Mus musculus OX=10090 GN=Baat PE=1 SV=1
4	A2AKK5	4.46e-160	459	416	0.548	0.550	ACNT1_MOUSE Acyl-coenzyme A amino acid N-acyltransferase 1 OS=Mus musculus OX=10090 GN=Acnat1 PE=1 SV=1
5	Q86TX2	1.85e-112	338	421	0.440	0.437	ACOT1_HUMAN Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1
6	P49753	1.99e-111	337	483	0.440	0.381	ACOT2_HUMAN Acyl-coenzyme A thioesterase 2, mitochondrial OS=Homo sapiens OX=9606 GN=ACOT2 PE=1 SV=6
7	Q9QYR7	5.44e-109	329	432	0.426	0.412	ACOT3_MOUSE Acyl-coenzyme A thioesterase 3 OS=Mus musculus OX=10090 GN=Acot3 PE=1 SV=1
8	O55171	2.95e-107	325	453	0.419	0.386	ACOT2_RAT Acyl-coenzyme A thioesterase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acot2 PE=1 SV=1
9	O88267	5.12e-107	324	419	0.414	0.413	ACOT1_RAT Acyl-coenzyme A thioesterase 1 OS=Rattus norvegicus OX=10116 GN=Acot1 PE=1 SV=1
10	Q9QYR9	1.13e-106	324	453	0.419	0.386	ACOT2_MOUSE Acyl-coenzyme A thioesterase 2, mitochondrial OS=Mus musculus OX=10090 GN=Acot2 PE=1 SV=2
11	O55137	7.76e-106	321	419	0.414	0.413	ACOT1_MOUSE Acyl-coenzyme A thioesterase 1 OS=Mus musculus OX=10090 GN=Acot1 PE=1 SV=1
12	Q8BWN8	5.21e-105	319	421	0.411	0.409	ACOT4_MOUSE Peroxisomal succinyl-coenzyme A thioesterase OS=Mus musculus OX=10090 GN=Acot4 PE=1 SV=1
13	Q6Q2Z6	2.49e-101	309	421	0.411	0.409	ACOT5_MOUSE Acyl-coenzyme A thioesterase 5 OS=Mus musculus OX=10090 GN=Acot5 PE=1 SV=2
14	Q3I5F7	2.03e-97	299	421	0.423	0.420	ACOT6_HUMAN Acyl-coenzyme A thioesterase 6 OS=Homo sapiens OX=9606 GN=ACOT6 PE=2 SV=2
15	Q32Q92	5.81e-96	295	419	0.416	0.415	ACOT6_MOUSE Acyl-coenzyme A thioesterase 6 OS=Mus musculus OX=10090 GN=Acot6 PE=1 SV=1
16	Q8N9L9	4.26e-90	280	421	0.440	0.437	ACOT4_HUMAN Peroxisomal succinyl-coenzyme A thioesterase OS=Homo sapiens OX=9606 GN=ACOT4 PE=1 SV=2
17	Q9Y6L7	1.9	33.5	1015	0.053	0.022	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
18	Q9STY0	2.5	32.3	227	0.048	0.088	PX11B_ARATH Peroxisomal membrane protein 11B OS=Arabidopsis thaliana OX=3702 GN=PEX11B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08840 BAAT_C	3.5e-69	244.6	BAAT / Acyl-CoA thioester hydrolase C terminal
2	PF04775 Bile_Hydr_Trans	4.4e-39	144.8	Acyl-CoA thioester hydrolase/BAAT N-terminal region
3	PF01738 DLH	0.063	24.4	Dienelactone hydrolase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259407

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263093	0.967	Bile acyl-CoA synthetase
2	9606.ENSP00000217455	0.965	Acyl-coenzyme A thioesterase 8
3	9606.ENSP00000285737	0.965	Lon protease homolog 2, peroxisomal
4	9606.ENSP00000307697	0.964	Peroxisomal acyl-coenzyme A oxidase 2
5	9606.ENSP00000355607	0.964	Glyceronephosphate O-acyltransferase
6	9606.ENSP00000265322	0.962	Peroxisomal trans-2-enoyl-CoA reductase
7	9606.ENSP00000348775	0.962	Peroxisomal acyl-coenzyme A oxidase 3
8	9606.ENSP00000368066	0.960	Hydroxyacid oxidase 1
9	9606.ENSP00000369461	0.957	Enoyl-CoA delta isomerase 2, mitochondrial
10	9606.ENSP00000231887	0.954	Peroxisomal bifunctional enzyme
11	9606.ENSP00000413575	0.947	Peroxisomal carnitine O-octanoyltransferase
12	9606.ENSP00000262430	0.946	Malonyl-CoA decarboxylase, mitochondrial
13	9606.ENSP00000483507	0.946	Hydroxyacid oxidase 2
14	9606.ENSP00000302620	0.945	Alanine-glyoxylate aminotransferase
15	9606.ENSP00000371517	0.943	Alpha-methylacyl-CoA racemase
16	9606.ENSP00000317721	0.942	Peroxisomal sarcosine oxidase
17	9606.ENSP00000420914	0.939	Peroxisomal multifunctional enzyme type 2
18	9606.ENSP00000221418	0.935	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
19	9606.ENSP00000293217	0.935	Peroxisomal acyl-coenzyme A oxidase 1
20	9606.ENSP00000360569	0.934	Non-specific lipid-transfer protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016747	1.000	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0047617	1.000	acyl-CoA hydrolase activity
GO:0005515	0.982	protein binding
GO:0016410	0.931	N-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044281	0.988	small molecule metabolic process
GO:0006629	0.981	lipid metabolic process
GO:0032787	0.981	monocarboxylic acid metabolic process
GO:1901360	0.958	organic cyclic compound metabolic process
GO:0008202	0.931	steroid metabolic process
GO:1901615	0.896	organic hydroxy compound metabolic process
GO:0008206	0.853	bile acid metabolic process
GO:0006807	0.730	nitrogen compound metabolic process
GO:1901564	0.690	organonitrogen compound metabolic process
GO:0034641	0.546	cellular nitrogen compound metabolic process
GO:0033875	0.384	ribonucleoside bisphosphate metabolic process
GO:0034032	0.384	purine nucleoside bisphosphate metabolic process
GO:0043603	0.383	amide metabolic process
GO:0009150	0.376	purine ribonucleotide metabolic process
GO:0006637	0.364	acyl-CoA metabolic process
GO:0044255	0.314	cellular lipid metabolic process
GO:1901576	0.300	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005777	0.999	peroxisome
GO:0070013	0.998	intracellular organelle lumen
GO:0005782	0.937	peroxisomal matrix
GO:0016020	0.560	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:16781	1.000	a fatty acyl-CoA + H2O = a fatty acid + CoA + H(+)
EC:3.1.2.20	1.000	acyl-CoA hydrolase.

[back to server]