StarFunc result for job id Q14088

User Input

>input (237 residues)
MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGT
FPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVT
KMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFET
SAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14088	1.000	1.000	1.370E-47	237	1.000	1.000	Q14088.pdb.gz	RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens OX=9606 GN=RAB33A PE=1 SV=2
2	AFDB:Q0P3Y1	0.823	0.827	1.095E-38	236	0.764	0.767	Q0P3Y1.pdb.gz	Q0P3Y1_DANRE RAB33A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab33a PE=2 SV=1
3	AFDB:F1LW77	0.758	0.783	5.041E-32	229	0.561	0.581	F1LW77.pdb.gz	F1LW77_RAT RAB33B, member RAS oncogene family OS=Rattus norvegicus OX=10116 GN=Rab33b PE=3 SV=2
4	AFDB:Q498P3	0.724	0.718	4.849E-31	239	0.574	0.569	Q498P3.pdb.gz	Q498P3_DANRE RAB33B, member RAS oncogene family a OS=Danio rerio OX=7955 GN=zgc:114080 PE=1 SV=1
5	AFDB:Q9VM50	0.730	0.774	6.924E-24	223	0.354	0.377	Q9VM50.pdb.gz	Q9VM50_DROME RE14786p OS=Drosophila melanogaster OX=7227 GN=Rab30 PE=2 SV=1
6	AFDB:P01123	0.749	0.855	1.568E-23	206	0.359	0.413	P01123.pdb.gz	YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPT1 PE=1 SV=2
7	AFDB:A8K5R1	0.684	0.794	1.670E-23	203	0.405	0.473	A8K5R1.pdb.gz	A8K5R1_HUMAN RAB30, member RAS oncogene family, isoform CRA_a OS=Homo sapiens OX=9606 GN=RAB30 PE=2 SV=1
8	AFDB:P11620	0.707	0.819	2.147E-23	203	0.346	0.404	P11620.pdb.gz	YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt1 PE=1 SV=2
9	AFDB:G5EFC1	0.732	0.817	3.551E-23	211	0.321	0.360	G5EFC1.pdb.gz	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
10	AFDB:A4FVK4	0.734	0.833	4.027E-23	207	0.346	0.396	A4FVK4.pdb.gz	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
11	PDB:2ew1A	0.674	0.926	3.845E-21	171	0.367	0.509	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
12	PDB:5szhB	0.670	0.898	9.274E-21	175	0.329	0.446	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:6if2B	0.680	0.896	4.466E-20	178	0.354	0.472	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
14	PDB:5szjA	0.656	0.880	4.756E-20	175	0.308	0.417	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:2f9mA	0.685	0.880	1.301E-19	182	0.295	0.385	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
16	PDB:5sziA	0.679	0.915	4.872E-19	174	0.312	0.425	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
17	PDB:6s5fA	0.671	0.837	3.213E-18	188	0.338	0.426	6s5fA.pdb.gz	Structure of the human RAB39B in complex with GMPPNP
18	PDB:7sd0B	0.629	0.841	5.314E-18	174	0.224	0.305	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
19	PDB:1ukvY	0.644	0.767	6.026E-18	197	0.342	0.411	1ukvY.pdb.gz	Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
20	PDB:8a4cB	0.639	0.877	6.417E-18	170	0.245	0.341	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14088	0.0	497	237	1.000	1.000	RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens OX=9606 GN=RAB33A PE=1 SV=2
2	Q0P3Y1	3.08e-131	371	236	0.751	0.754	Q0P3Y1_DANRE RAB33A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab33a PE=2 SV=1
3	Q9H082	3.30e-93	275	229	0.523	0.541	RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens OX=9606 GN=RAB33B PE=1 SV=1
4	O35963	5.46e-93	274	229	0.536	0.555	RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus OX=10090 GN=Rab33b PE=1 SV=1
5	F1LW77	5.65e-93	274	229	0.536	0.555	F1LW77_RAT RAB33B, member RAS oncogene family OS=Rattus norvegicus OX=10116 GN=Rab33b PE=3 SV=2
6	Q498P3	9.24e-88	261	239	0.553	0.548	Q498P3_DANRE RAB33B, member RAS oncogene family a OS=Danio rerio OX=7955 GN=zgc:114080 PE=1 SV=1
7	P01123	1.75e-52	170	206	0.350	0.403	YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPT1 PE=1 SV=2
8	Q6FLX7	3.99e-51	167	206	0.342	0.393	Q6FLX7_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K12672g PE=4 SV=1
9	A8K5R1	4.78e-51	166	203	0.367	0.429	A8K5R1_HUMAN RAB30, member RAS oncogene family, isoform CRA_a OS=Homo sapiens OX=9606 GN=RAB30 PE=2 SV=1
10	Q15771	4.78e-51	166	203	0.367	0.429	RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=2
11	P11620	2.80e-50	164	203	0.333	0.389	YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt1 PE=1 SV=2
12	E9PMJ1	3.89e-50	163	168	0.359	0.506	E9PMJ1_HUMAN RAB30, member RAS oncogene family (Fragment) OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=1
13	Q9VM50	7.34e-50	164	223	0.350	0.372	Q9VM50_DROME RE14786p OS=Drosophila melanogaster OX=7227 GN=Rab30 PE=2 SV=1
14	P62820	1.01e-49	163	205	0.338	0.390	RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens OX=9606 GN=RAB1A PE=1 SV=3
15	P62821	1.01e-49	163	205	0.338	0.390	RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus OX=10090 GN=Rab1A PE=1 SV=3
16	P62822	1.01e-49	163	205	0.338	0.390	RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris OX=9615 GN=RAB1A PE=1 SV=3
17	Q6NYB7	1.01e-49	163	205	0.338	0.390	RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus OX=10116 GN=Rab1A PE=1 SV=3
18	D6XMQ7	7.62e-49	161	208	0.333	0.380	D6XMQ7_TRYB2 Small GTP-binding protein Rab1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.530 PE=4 SV=1
19	Q67BJ9	7.62e-49	161	208	0.333	0.380	Q67BJ9_9TRYP Rab1 OS=Trypanosoma brucei OX=5691 PE=2 SV=1
20	Q5AI00	7.80e-49	161	207	0.342	0.391	Q5AI00_CANAL Rab family GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YPT1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	1.2e-11	55.9	ADP-ribosylation factor family
2	PF02421 FeoB_N	3.9e+02	11.9	Ferrous iron transport protein B
3	PF00503 G-alpha	1.6	19.4	G-protein alpha subunit
4	PF00009 GTP_EFTU	0.062	24.4	Elongation factor Tu GTP binding domain
5	PF04670 Gtr1_RagA	0.00038	31.5	Gtr1/RagA G protein conserved region
6	PF01926 MMR_HSR1	0.00088	30.7	50S ribosome-binding GTPase
7	PF10662 PduV-EutP	64	14.8	Ethanolamine utilisation - propanediol utilisation
8	PF00071 Ras	5.2e-47	170.9	Ras family
9	PF08477 Roc	5.7e-29	112.2	Ras of Complex, Roc, domain of DAPkinase
10	PF09439 SRPRB	0.053	24.5	Signal recognition particle receptor beta subunit
11	PF05621 TniB	86	14.0	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9707.XP_004400295.1

Rank	PPI partner	STRING score	Description
1	9707.XP_004396120.1	0.820	Autophagy-related protein 16-1 isoform 1
2	9707.XP_004410470.1	0.808	Ras-related protein Rab-9A
3	9707.XP_004414418.1	0.805	Ras-related protein Rab-12 isoform 1
4	9707.XP_004395754.1	0.800	Ras-related protein Rab-7a isoform 1
5	9707.XP_004412195.1	0.794	Ras-related protein Rab-11B
6	9707.XP_004414583.1	0.793	Ras-related protein Rab-11A isoform 1
7	9707.XP_004402985.1	0.792	Ras-related protein Rab-25
8	9707.XP_004406395.1	0.784	General vesicular transport factor p115
9	9707.XP_004415828.1	0.777	Ras-related protein Rab-9B isoform 1
10	9707.XP_004399718.1	0.775	Ras-related protein Rab-34 isoform 1
11	9707.XP_004400622.1	0.775	Ras-related protein Rab-36
12	9707.XP_004412666.1	0.774	Belongs to the TRAPP small subunits family.
13	9707.XP_004392894.1	0.771	Ras-related protein Rab-7b-like
14	9707.XP_004398537.1	0.765	Belongs to the TRAPP small subunits family.
15	9707.XP_004409431.1	0.761	Ras-related protein Rab-15
16	9707.XP_004394964.1	0.759	Ras-related protein Rab-10
17	9707.XP_004398011.1	0.754	Trafficking protein particle complex subunit 3-like protein
18	9707.XP_004402722.1	0.754	May play a role in vesicular transport from endoplasmic reticulum to Golgi
19	9707.XP_004411873.1	0.752	Rab GDP dissociation inhibitor beta isoform 1
20	9707.XP_004414560.1	0.752	Rab GDP dissociation inhibitor alpha isoform 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003924	0.998	GTPase activity
GO:0097159	0.888	organic cyclic compound binding
GO:1901363	0.885	heterocyclic compound binding
GO:0043167	0.827	ion binding
GO:0017076	0.691	purine nucleotide binding
GO:0019001	0.670	guanyl nucleotide binding
GO:0043168	0.612	anion binding
GO:0032561	0.612	guanyl ribonucleotide binding
GO:0035639	0.546	purine ribonucleoside triphosphate binding
GO:0005525	0.502	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.945	cellular process
GO:0019882	0.831	antigen processing and presentation
GO:0065007	0.584	biological regulation
GO:0051179	0.577	localization
GO:0050789	0.566	regulation of biological process
GO:0050794	0.545	regulation of cellular process
GO:0006810	0.530	transport
GO:0071840	0.390	cellular component organization or biogenesis
GO:0016043	0.359	cellular component organization
GO:0016192	0.341	vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0016020	0.997	membrane
GO:0098588	0.975	bounding membrane of organelle
GO:0005794	0.962	Golgi apparatus
GO:0000139	0.892	Golgi membrane
GO:0031982	0.843	vesicle
GO:0097708	0.684	intracellular vesicle
GO:0031410	0.567	cytoplasmic vesicle
GO:0005829	0.527	cytosol
GO:0005886	0.300	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.998	GTP + H2O = GDP + H(+) + phosphate

[back to server]